Record in detail


General Info

  • lamp_id:L01A003477
  • Name:KBX3_HADGE
  • FullName:Hge-scorpine
  • Source:Hadrurus gertschi
  • Mass:8374.9 Da
  • Sequence Length:76 aa
  • Isoelectric Point:9.45
  • Activity:Antibacterial
  • Sequence
        GWMSEKKVQGILDKKLPEGIIRNAAKAIVHKMAKNQFGCFANVDVKGDCKRHCKAEDKEGICHGTKCKCGVPISYL
  • Function:Hge-scorpine has antibacterial activity against B.subtilis, but not against S.aureus. Also has hemolytic and cytolytic activities.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003477    From 1 To 76 E-value: 2e-40 Score: 155
        GWMSEKKVQGILDKKLPEGIIRNAAKAIVHKMAKNQFGCFANVDVKGDCKRHCKAEDKEGICHGTKCKCGVPISYL
  • 2. L13A020479    From 1 To 50 E-value: 1e-24 Score: 103
        GWMSEKKVQGILDKKLPEGIIRNAAKAIVHKMAKNQFGCFANVDVKGDCK
  • 3. L12A04351|    From 1 To 76 E-value: 1e-23 Score: 99.8
        GWITEKKIQKVLDEKLPNGFIKGAAKAVVHKLAKSEYGCMMDISWNKDCQRHCQSTEQKDGICHGMKCKCGKPRSY
  • 4. L03A000236    From 20 To 94 E-value: 3e-22 Score: 95.5
        GWINEEKIQKKIDERMGNTVLGGMAKAIVHKMAKNEFQCMANMDMLGNCEKHCQTSGEKGYCHGTKCKCGTPLSY
  • 5. L01A002885    From 1 To 75 E-value: 4e-22 Score: 95.1
        GWINEEKIQKKIDERMGNTVLGGMAKAIVHKMAKNEFQCMANMDMLGNCEKHCQTSGEKGYCHGTKCKCGTPLSY

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Possani L.D.,Rodriguez de la Vega R.C.,Diego-Garcia E.,Schwartz E.F.,
  •   Title:Transcriptome analysis of the venom gland of the Mexican scorpion Hadrurus gertschi (Arachnida: Scorpiones).
  •   Journal:BMC Genomics, 2007, 8, 119-119  [PubMed:17506894]
  •   [2]  Batista C.V.,Gonzalez S.A.,D"Suze G.,Schwartz E.F.,Diego-Garcia E.,
  •   Title:Wide phylogenetic distribution of scorpine and long-chain beta-KTx-like peptides in scorpion venoms: identification of "orphan" components.
  •   Journal:Peptides, 2007, 28, 31-37  [PubMed:17141373]
  •   [3]  Tytgat J.,Rodriguez de la Vega R.C.,Schwartz E.F.,Abdel-Mottaleb Y.,Diego-Garcia E.,
  •   Title:Cytolytic and K+ channel blocking activities of beta-KTx and scorpine-like peptides purified from scorpion venoms.
  •   Journal:Cell. Mol. Life Sci., 2008, 65, 187-200  [PubMed:18030427]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: