Record in detail


General Info

  • lamp_id:L01A003478
  • Name:DFA21_MOUSE
  • FullName:Alpha-defensin 21
  • Source:Mus musculus
  • Mass:4221.9 Da
  • Sequence Length:35 aa
  • Isoelectric Point:10.81
  • Activity:Antimicrobial
  • Sequence
        SRDLICLCRNRRCNRGELFYGTCAGPFLRCCRRRR
  • Function:May have microbicidal activities (By similarity).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003478    From 1 To 35 E-value: 0.00000000000003 Score: 68.6
        SRDLICLCRNRRCNRGELFYGTCAGPFLRCCRRRR
  • 2. L01A003479    From 1 To 35 E-value: 0.0000000000001 Score: 67
        SRDLICLCRKRRCNRGELFYGTCAGPFLRCCRRRR
  • 3. L01A003473    From 1 To 34 E-value: 0.0000005 Score: 44.7
        SRDLICYCRKGGCNRGEQVYGTCSGRLLYCCPRR
  • 4. L03A000076    From 57 To 89 E-value: 0.002 Score: 33.1
        RGLLCYCRKGHCKRGERVRGTCGIRFLYCCPRR
  • 5. L12A08329|    From 60 To 92 E-value: 0.002 Score: 33.1
        RGLLCYCRKGHCKRGERVRGTCGIRFLYCCPRR

Structure

  •   Domains
  •   1  Name:Alpha-defensin    Interpro Link:IPR016327
  •   2  Name:Defensin_beta-typ    Interpro Link:IPR001855
  •   3  Name:Defensin_beta/neutrophil    Interpro Link:IPR006080
  •   4  Name:Defensin_propep    Interpro Link:IPR002366
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Zhang G.,Hughes A.L.,Patil A.,
  •   Title:Rapid evolution and diversification of mammalian alpha-defensins as revealed by comparative analysis of rodent and primate genes.
  •   Journal:Physiol. Genomics, 2004, 20, 1-11  [PubMed:15494476]
  •   [2]  Frith M.C.,Gough J.,Katayama S.,Kasukawa T.,Carninci P.,
  •   Title:The transcriptional landscape of the mammalian genome.
  •   Journal:Science, 2005, 309, 1559-1563  [PubMed:16141072]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: