Record in detail


General Info

  • lamp_id:L01A003487
  • Name:D108B_HUMAN
  • FullName:Beta-defensin 108B
  • Source:Homo sapiens
  • Mass:5815.6 Da
  • Sequence Length:51 aa
  • Isoelectric Point:7.78
  • Activity:Antibacterial
  • Sequence
        KFKEICERPNGSCRDFCLETEIHVGRCLNSQPCCLPLGHQPRIESTTPKKD
  • Function:Has antibacterial activity (By similarity).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003487    From 1 To 51 E-value: 2e-25 Score: 106
        KFKEICERPNGSCRDFCLETEIHVGRCLNSQPCCLPLGHQPRIESTTPKKD
  • 2. L01A003576    From 1 To 51 E-value: 5e-25 Score: 104
        KFKEICERPNGSCRDFCLETEIHVGRCLNSRPCCLPLGHQPRIESTTPKKD
  • 3. L12A08188|    From 33 To 83 E-value: 6e-25 Score: 104
        KFKEICERPNGSCRDFCLETEIHVGRCLNSRPCCLPLGHQPRIESTTLKKD
  • 4. L12A05005|    From 1 To 51 E-value: 1e-24 Score: 103
        KFKEICERPNGSCRDFCLETEIHLGRCLNSRPCCLPLGHQPRIESTTPKKD
  • 5. L12A00509|    From 4 To 54 E-value: 1e-24 Score: 103
        KFKEICERPDGSCRDFCLETEIHVGRCLNSRPCCLPLGHQPRIESTTPKKD

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Jia H.P.,Walters J.D.,Bartlett J.A.,Mitros J.P.,Schutte B.C.,
  •   Title:Discovery of five conserved beta-defensin gene clusters using a computational search strategy.
  •   Journal:Proc. Natl. Acad. Sci. U.S.A., 2002, 99, 2129-2133  [MEDLINE:21843921]
  •   [2]  Dorin J.R.,Rolfe M.,Semple C.A.M.,
  •   Title:Duplication and selection in the evolution of primate beta-defensin genes.
  •   Journal:Genome Biol., 2003, 4, 0-0  [MEDLINE:22619651]
  •   [3]  Wu R.,Zhao Y.H.,Chen Y.,Kao C.Y.,
  •   Title:ORFeome-based search of airway epithelial cell-specific novel human beta-defensin genes.
  •   Journal:Am. J. Respir. Cell Mol. Biol., 2003, 29, 71-80  [MEDLINE:22705149]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: