Record in detail
General Info
- lamp_id:L01A003488
- Name:DEFB4_RAT
- FullName:Beta-defensin 4
- Source:Rattus norvegicus
- Mass:4382.2 Da
- Sequence Length:41 aa
- Isoelectric Point:9.79
- Activity:Antibacterial
- Sequence
QSINNPITCLTKGGVCWGPCTGGFRQIGTCGLPRVRCCKKK - Function:Has bactericidal activity (By similarity).
Cross-Linking
- Cross-linking
- 1 Database:CAMP CAMPSQ1903
- 2 Database:dbAMP dbAMP_10271
- 3 Database:DRAMP DRAMP03426
- 4 Database:Uniprot O88514
- 5 Database:DEF DEF135
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L03A000249 From 23 To 63 E-value: 2e-19 Score: 86.3
QSINNPITCLTKGGVCWGPCTGGFRQIGTCGLPRVRCCKKK - 2. L01A003488 From 1 To 41 E-value: 1e-18 Score: 83.2
QSINNPITCLTKGGVCWGPCTGGFRQIGTCGLPRVRCCKKK - 3. L01A003599 From 1 To 41 E-value: 0.00000000000008 Score: 67.4
QSINNPVSCVTHGGICWGRCPGSFRQIGTCGLGKVRCCKKK - 4. L03A000251 From 23 To 63 E-value: 0.000000000005 Score: 61.6
QIINNPITCMTNGAICWGPCPTAFRQIGNCGHFKVRCCKIR - 5. L01A003010 From 1 To 41 E-value: 0.00000000001 Score: 60.5
QIINNPITCMTNGAICWGPCPTAFRQIGNCGHFKVRCCKIR
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] Mallampali R.K.,Nishimura D.,Barahmand-Pour F.,Mills J.N.,Jia H.P.,
- Title:Molecular cloning and characterization of rat genes encoding homologues of human beta-defensins.
- Journal:Infect. Immun., 1999, 67, 4827-4833 [MEDLINE:99386883]
- [2] Zhang G.,Blecha F.,Sang Y.,Cai Y.,Patil A.A.,
- Title:Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract.
- Journal:Physiol. Genomics, 2005, 23, 5-17 [PubMed:16033865]
Comments
- Comments
No comments found on LAMP database