Record in detail


General Info

  • lamp_id:L01A003493
  • Name:DB119_PONPY
  • FullName:Beta-defensin 119
  • Source:Pongo pygmaeus
  • Mass:7550.6 Da
  • Sequence Length:63 aa
  • Isoelectric Point:9.05
  • Activity:Antibacterial
  • Sequence
        KRYILRCMGNSGICRASCKRNEQPYLYCKNYQSCCLQSYMRISISGKEENTDWSYEKQWPKLP
  • Function:Has antibacterial activity (Potential).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003493    From 1 To 63 E-value: 7e-33 Score: 130
        KRYILRCMGNSGICRASCKRNEQPYLYCKNYQSCCLQSYMRISISGKEENTDWSYEKQWPKLP
  • 2. L12A08219|    From 22 To 84 E-value: 9e-32 Score: 127
        KRHILRCMGNSGICRASCKKNEQPYLYCRNYQACCLQSYMRISISGKEENTDWSYEKQWPRLP
  • 3. L12A03232|    From 2 To 64 E-value: 2e-31 Score: 125
        KRHILRCMGNSGICRASCKKNEQPYLYCRNYQACCLQSYMRISISGKEENTDWSYEKQWPRLP
  • 4. L01A003514    From 1 To 63 E-value: 2e-31 Score: 125
        KRHILRCMGNSGICRASCKKNEQPYLYCRNYQACCLQSYMRISISGKEENTDWSYEKQWPRLP
  • 5. L01A003496    From 1 To 63 E-value: 3e-31 Score: 125
        KRHILRCMGNSGICRASCKKNEQPYLYCRNYQSCCLQSYMRISISGKEEDTDWSYEKQWPRLP

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: