Record in detail


General Info

  • lamp_id:L01A003498
  • Name:DB118_MACFA
  • FullName:Beta-defensin 118
  • Source:Macaca fascicularis
  • Mass:4864.4 Da
  • Sequence Length:43 aa
  • Isoelectric Point:8.39
  • Activity:Antibacterial
  • Sequence
        AYGGEKKCWNRSGHCRKQCKDGEAVKETCKNHRACCVPSNEDH
  • Function:Has antibacterial activity (Potential).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003498    From 1 To 43 E-value: 2e-20 Score: 89.7
        AYGGEKKCWNRSGHCRKQCKDGEAVKETCKNHRACCVPSNEDH
  • 2. L01A003497    From 1 To 43 E-value: 8e-19 Score: 84
        AYSGEKKCWNRSGHCRKQCKDGEAVKDTCKNLRACCVPSNEDH
  • 3. L01A003520    From 1 To 43 E-value: 1e-18 Score: 84
        AYSGEKKCWNRSGHCRKQCKDGEAVKDTCKNLRACCIPSNEDH
  • 4. L12A10533|    From 29 To 62 E-value: 0.0000000002 Score: 56.6
        RKCLNKSGTCRKHCKDGEEIKEACKNHRICCIPS
  • 5. L05ADEF343    From 21 To 62 E-value: 0.0000000009 Score: 53.9
        YSAEKRCLNRLGHCKRKCKAGEMVMETCKYFQVCCVLDDNDY

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: