Record in detail
General Info
- lamp_id:L01A003501
- Name:D107A_PONPY
- FullName:Beta-defensin 107A
- Source:Pongo pygmaeus
- Mass:5001.9 Da
- Sequence Length:44 aa
- Isoelectric Point:8.64
- Activity:Antibacterial
- Sequence
AIHRALICKRMEGHCEAECLTFEVKIGGCRAELAPFCCKNRKKH - Function:Has antibacterial activity (By similarity).
Cross-Linking
- Cross-linking
- 1 Database:CAMP CAMPSQ1918
- 2 Database:dbAMP dbAMP_00239
- 3 Database:DRAMP DRAMP02729
- 4 Database:Uniprot A4H216
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L12A06097| From 7 To 50 E-value: 1e-20 Score: 90.5
AIHRALICKRMEGHCEAECLTFEVKIGGCRAELAPFCCKNRKKH - 2. L01A003501 From 1 To 44 E-value: 2e-20 Score: 89.7
AIHRALICKRMEGHCEAECLTFEVKIGGCRAELAPFCCKNRKKH - 3. L12A10783| From 3 To 46 E-value: 4e-20 Score: 88.6
AIHRALICKRMEGHCEAECLTFEAKIGGCRAELAPFCCKNRKKH - 4. L01A003504 From 1 To 44 E-value: 5e-20 Score: 88.2
AIHRALICKRMEGHCEAECLTFEAKIGGCRAELAPFCCKNRKKH - 5. L01A002535 From 1 To 44 E-value: 6e-20 Score: 87.8
AIHRALISKRMEGHCEAECLTFEVKIGGCRAELAPFCCKNRKKH
Structure
- Domains
No domains found on LAMP database
- Structures
No structs found on LAMP database
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
No references found on LAMP database
Comments
- Comments
No comments found on LAMP database