Record in detail


General Info

  • lamp_id:L01A003502
  • Name:D107A_MACFA
  • FullName:Beta-defensin 107A
  • Source:Macaca fascicularis
  • Mass:5040 Da
  • Sequence Length:44 aa
  • Isoelectric Point:8.62
  • Activity:Antibacterial
  • Sequence
        AIHRALICKRMEGHCEAECLTFEVKIGGCRAELTPYCCKKRKKD
  • Function:Has antibacterial activity (By similarity).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003502    From 1 To 44 E-value: 1e-20 Score: 90.1
        AIHRALICKRMEGHCEAECLTFEVKIGGCRAELTPYCCKKRKKD
  • 2. L12A00241|    From 1 To 43 E-value: 7e-20 Score: 87.4
        AIHRALICKRMEGHCEAECLTFEVKIGGCRAELTPYCCKKRKK
  • 3. L12A00243|    From 1 To 43 E-value: 2e-19 Score: 86.3
        AIHRALICKRMEGHCEAECLTFEVKIGGCRAELTPYCCKRRKK
  • 4. L12A00240|    From 1 To 41 E-value: 6e-19 Score: 84.3
        AIHRALICKRMEGHCEAECLTFEVKIGGCRAELTPYCCKKR
  • 5. L12A06097|    From 7 To 49 E-value: 1e-18 Score: 83.6
        AIHRALICKRMEGHCEAECLTFEVKIGGCRAELAPFCCKNRKK

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: