Record in detail
General Info
- lamp_id:L01A003502
- Name:D107A_MACFA
- FullName:Beta-defensin 107A
- Source:Macaca fascicularis
- Mass:5040 Da
- Sequence Length:44 aa
- Isoelectric Point:8.62
- Activity:Antibacterial
- Sequence
AIHRALICKRMEGHCEAECLTFEVKIGGCRAELTPYCCKKRKKD - Function:Has antibacterial activity (By similarity).
Cross-Linking
- Cross-linking
- 1 Database:CAMP CAMPSQ7609
- 2 Database:dbAMP dbAMP_00242
- 3 Database:DRAMP DRAMP02617
- 4 Database:Uniprot A4H218
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L01A003502 From 1 To 44 E-value: 1e-20 Score: 90.1
AIHRALICKRMEGHCEAECLTFEVKIGGCRAELTPYCCKKRKKD - 2. L12A00241| From 1 To 43 E-value: 7e-20 Score: 87.4
AIHRALICKRMEGHCEAECLTFEVKIGGCRAELTPYCCKKRKK - 3. L12A00243| From 1 To 43 E-value: 2e-19 Score: 86.3
AIHRALICKRMEGHCEAECLTFEVKIGGCRAELTPYCCKRRKK - 4. L12A00240| From 1 To 41 E-value: 6e-19 Score: 84.3
AIHRALICKRMEGHCEAECLTFEVKIGGCRAELTPYCCKKR - 5. L12A06097| From 7 To 49 E-value: 1e-18 Score: 83.6
AIHRALICKRMEGHCEAECLTFEVKIGGCRAELAPFCCKNRKK
Structure
- Domains
No domains found on LAMP database
- Structures
No structs found on LAMP database
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
No references found on LAMP database
Comments
- Comments
No comments found on LAMP database