Record in detail


General Info

  • lamp_id:L01A003504
  • Name:D107A_GORGO
  • FullName:Beta-defensin 107A
  • Source:Gorilla gorilla gorilla
  • Mass:4973.9 Da
  • Sequence Length:44 aa
  • Isoelectric Point:8.64
  • Activity:Antibacterial
  • Sequence
        AIHRALICKRMEGHCEAECLTFEAKIGGCRAELAPFCCKNRKKH
  • Function:Has antibacterial activity (By similarity).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A10783|    From 3 To 46 E-value: 2e-20 Score: 89.7
        AIHRALICKRMEGHCEAECLTFEAKIGGCRAELAPFCCKNRKKH
  • 2. L01A003504    From 1 To 44 E-value: 2e-20 Score: 89.4
        AIHRALICKRMEGHCEAECLTFEAKIGGCRAELAPFCCKNRKKH
  • 3. L12A06097|    From 7 To 50 E-value: 3e-20 Score: 89
        AIHRALICKRMEGHCEAECLTFEVKIGGCRAELAPFCCKNRKKH
  • 4. L01A003501    From 1 To 44 E-value: 5e-20 Score: 88.2
        AIHRALICKRMEGHCEAECLTFEVKIGGCRAELAPFCCKNRKKH
  • 5. L01A002535    From 1 To 44 E-value: 2e-19 Score: 86.3
        AIHRALISKRMEGHCEAECLTFEVKIGGCRAELAPFCCKNRKKH

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: