Record in detail


General Info

  • lamp_id:L01A003506
  • Name:DB119_CANFA
  • FullName:Beta-defensin 119
  • Source:Canis familiaris
  • Mass:7541.6 Da
  • Sequence Length:63 aa
  • Isoelectric Point:8.84
  • Activity:Antibacterial
  • Sequence
        KHHILRCMGNTGICRPSCRKTEQPYLYCLNYQSCCLQSYMRISISGREEKDDWSQQNRWPKIS
  • Function:Has antibacterial activity (Potential).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003506    From 1 To 63 E-value: 1e-33 Score: 133
        KHHILRCMGNTGICRPSCRKTEQPYLYCLNYQSCCLQSYMRISISGREEKDDWSQQNRWPKIS
  • 2. L12A10459|    From 1 To 62 E-value: 2e-30 Score: 122
        RHHTLRCMGNTGVCRPSCRRTEHPYLYCLNYQPCCLQSYMRISIAGREEKDDWSQENRWPKI
  • 3. L12A05974|    From 1 To 59 E-value: 2e-28 Score: 115
        LRCMGNTGICRSSCRKTEQPYLYCLNYQSCCLQSYMKISISVREEKNDWSQQNRWPKIS
  • 4. L12A07860|    From 21 To 83 E-value: 2e-25 Score: 105
        RRQILQCMGNMGICRPSCKKNEQPYLYCRNYQSCCLQSYMRINLAGSEENTGWSQENRWPKIS
  • 5. L01A003495    From 1 To 62 E-value: 4e-25 Score: 105
        KHHILRCMGNSGICRASCKKNEQPYLYCRNYQHCCLQSYMRISISGEEENTDWSYEKQWPRL

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Zhang G.,Blecha F.,Sang Y.,Cai Y.,Patil A.A.,
  •   Title:Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract.
  •   Journal:Physiol. Genomics, 2005, 23, 5-17  [PubMed:16033865]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: