Record in detail


General Info

  • lamp_id:L01A003507
  • Name:DB131_PANTR
  • FullName:Beta-defensin 131
  • Source:Pan troglodytes
  • Mass:5886.7 Da
  • Sequence Length:49 aa
  • Isoelectric Point:7.3
  • Activity:Antibacterial
  • Sequence
        FISNDECPSEYYYHCRLKCNADEHAIRYCADFSICCKLKIIEIHGQKKW
  • Function:Has antibacterial activity (Potential).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003507    From 1 To 49 E-value: 1e-24 Score: 103
        FISNDECPSEYYYHCRLKCNADEHAIRYCADFSICCKLKIIEIHGQKKW
  • 2. L12A00539|    From 4 To 51 E-value: 7e-22 Score: 94.4
        FISNDECPSEYY-HCRLKCNADEHAIRYCADFSICCKLKIIEIDGQKKW
  • 3. L01A003518    From 1 To 48 E-value: 9e-22 Score: 94
        FISNDECPSEYY-HCRLKCNADEHAIRYCADFSICCKLKIIEIDGQKKW
  • 4. L12A02367|    From 1 To 48 E-value: 4e-21 Score: 91.7
        FTSNDECPSEYY-HCRLKCNADEHAIRYCADFSICCKLKIIQIDGQKKW
  • 5. L12A01817|    From 1 To 48 E-value: 1e-20 Score: 90.1
        FISNNECPLEYY-HCRLKCNADEHAIRYCADFSICCKLKIIEIDGQKKW

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Zhang G.,Blecha F.,Sang Y.,Cai Y.,Patil A.A.,
  •   Title:Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract.
  •   Journal:Physiol. Genomics, 2005, 23, 5-17  [PubMed:16033865]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: