Record in detail


General Info

  • lamp_id:L01A003516
  • Name:IKP1_PHYSA
  • FullName:Proteinase inhibitor PSKP-1
  • Source:Phyllomedusa sauvagei
  • Mass:6701.9 Da
  • Sequence Length:58 aa
  • Isoelectric Point:9.57
  • Activity:Antibacterial
  • Sequence
        VIEPKCYKYEGKKCPPDINPVCGTDKRTYYNECALCVFIRQSTKKADKAIKIKKWGKC
  • Function:Has antibacterial activity against Gram-negative bacterium E.coli ATCC 11229. Shows hemagglutinating activity. Inhibits prolyl endopeptidase, but not trypsin, chymotrypsin, V8 protease and proteinase K. May have a role in mucosal defense against microbes by interacting directly with their membranes.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003516    From 1 To 58 E-value: 5e-29 Score: 117
        VIEPKCYKYEGKKCPPDINPVCGTDKRTYYNECALCVFIRQSTKKADKAIKIKKWGKC
  • 2. L13A023442    From 1 To 50 E-value: 1e-24 Score: 103
        VIEPKCYKYEGKKCPPDINPVCGTDKRTYYNECALCVFIRQSTKKADKAI

Structure

  •   Domains
  •   1  Name:Prot_inh_Kazal    Interpro Link:IPR002350
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  E. coli  EC:  20.11 μg/ml  (3.00064 μM)  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Faivovich J.,Burgardt N.I.,Stern A.L.,Carrizo F.U.,Gebhard L.G.,
  •   Title:A Kazal prolyl endopeptidase inhibitor isolated from the skin of Phyllomedusa sauvagii.
  •   Journal:Eur. J. Biochem., 2004, 271, 2117-2126  [PubMed:15153102]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: