Record in detail


General Info

  • lamp_id:L01A003517
  • Name:DB119_HUMAN
  • FullName:Beta-defensin 119
  • Source:Homo sapiens
  • Mass:7492.6 Da
  • Sequence Length:63 aa
  • Isoelectric Point:8.91
  • Activity:Antibacterial
  • Sequence
        KRHILRCMGNSGICRASCKKNEQPYLYCRNCQSCCLQSYMRISISGKEENTDWSYEKQWPRLP
  • Function:Has antibacterial activity (Potential).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003517    From 1 To 63 E-value: 3e-33 Score: 131
        KRHILRCMGNSGICRASCKKNEQPYLYCRNCQSCCLQSYMRISISGKEENTDWSYEKQWPRLP
  • 2. L12A08219|    From 22 To 84 E-value: 2e-32 Score: 129
        KRHILRCMGNSGICRASCKKNEQPYLYCRNYQACCLQSYMRISISGKEENTDWSYEKQWPRLP
  • 3. L01A003514    From 1 To 63 E-value: 5e-32 Score: 127
        KRHILRCMGNSGICRASCKKNEQPYLYCRNYQACCLQSYMRISISGKEENTDWSYEKQWPRLP
  • 4. L12A03232|    From 2 To 64 E-value: 6e-32 Score: 127
        KRHILRCMGNSGICRASCKKNEQPYLYCRNYQACCLQSYMRISISGKEENTDWSYEKQWPRLP
  • 5. L01A003496    From 1 To 63 E-value: 8e-32 Score: 127
        KRHILRCMGNSGICRASCKKNEQPYLYCRNYQSCCLQSYMRISISGKEEDTDWSYEKQWPRLP

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Gilbert J.G.R.,Burton J.,Ashurst J.L.,Matthews L.H.,Deloukas P.,
  •   Title:The DNA sequence and comparative analysis of human chromosome 20.
  •   Journal:Nature, 2001, 414, 865-871  [MEDLINE:21638749]
  •   [2]  Jia H.P.,Walters J.D.,Bartlett J.A.,Mitros J.P.,Schutte B.C.,
  •   Title:Discovery of five conserved beta-defensin gene clusters using a computational search strategy.
  •   Journal:Proc. Natl. Acad. Sci. U.S.A., 2002, 99, 2129-2133  [MEDLINE:21843921]
  •   [3]  Baldwin D.T.,Baker K.,Abaya E.,Gurney A.L.,Clark H.F.,
  •   Title:The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
  •   Journal:Genome Res., 2003, 13, 2265-2270  [MEDLINE:22887296]
  •   [4]  
  •   Title:The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
  •   Journal:Genome Res., 2004, 14, 2121-2127  [PubMed:15489334]
  •   [5]  French F.S.,Young S.L.,Yenugu S.,Hamil K.G.,Radhakrishnan Y.,
  •   Title:Identification, characterization, and evolution of a primate beta-defensin gene cluster.
  •   Journal:Genes Immun., 2005, 6, 203-210  [PubMed:15772680]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: