Record in detail


General Info

  • lamp_id:L01A003520
  • Name:DB118_HUMAN
  • FullName:Beta-defensin 118
  • Source:Homo sapiens
  • Mass:4870.4 Da
  • Sequence Length:43 aa
  • Isoelectric Point:8.39
  • Activity:Antibacterial
  • Sequence
        AYSGEKKCWNRSGHCRKQCKDGEAVKDTCKNLRACCIPSNEDH
  • Function:Has antibacterial activity (Potential).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003520    From 1 To 43 E-value: 9e-21 Score: 90.5
        AYSGEKKCWNRSGHCRKQCKDGEAVKDTCKNLRACCIPSNEDH
  • 2. L01A003497    From 1 To 43 E-value: 1e-20 Score: 90.1
        AYSGEKKCWNRSGHCRKQCKDGEAVKDTCKNLRACCVPSNEDH
  • 3. L01A003498    From 1 To 43 E-value: 1e-18 Score: 84
        AYGGEKKCWNRSGHCRKQCKDGEAVKETCKNHRACCVPSNEDH
  • 4. L05ADEF343    From 21 To 62 E-value: 0.000000001 Score: 53.9
        YSAEKRCLNRLGHCKRKCKAGEMVMETCKYFQVCCVLDDNDY
  • 5. L12A01274|    From 2 To 43 E-value: 0.000000001 Score: 53.5
        YSAEKRCLNRLGHCKRKCKAGEMVMETCKYFQVCCVLDDNDY

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Soundararajan R.,Grossman G.,Sivashanmugam P.,Hamil K.G.,Liu Q.,
  •   Title:Primate epididymis-specific proteins: characterization of ESC42, a novel protein containing a trefoil-like motif in monkey and human.
  •   Journal:Endocrinology, 2001, 142, 4529-4539  [MEDLINE:21448442]
  •   [2]  Gilbert J.G.R.,Burton J.,Ashurst J.L.,Matthews L.H.,Deloukas P.,
  •   Title:The DNA sequence and comparative analysis of human chromosome 20.
  •   Journal:Nature, 2001, 414, 865-871  [MEDLINE:21638749]
  •   [3]  Jia H.P.,Walters J.D.,Bartlett J.A.,Mitros J.P.,Schutte B.C.,
  •   Title:Discovery of five conserved beta-defensin gene clusters using a computational search strategy.
  •   Journal:Proc. Natl. Acad. Sci. U.S.A., 2002, 99, 2129-2133  [MEDLINE:21843921]
  •   [4]  Wu R.,Zhao Y.H.,Chen Y.,Kao C.Y.,
  •   Title:ORFeome-based search of airway epithelial cell-specific novel human beta-defensin genes.
  •   Journal:Am. J. Respir. Cell Mol. Biol., 2003, 29, 71-80  [MEDLINE:22705149]
  •   [5]  
  •   Title:The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
  •   Journal:Genome Res., 2004, 14, 2121-2127  [PubMed:15489334]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: