Record in detail


General Info

  • lamp_id:L01A003522
  • Name:CBA_CARML
  • FullName:Bacteriocin carnobacteriocin-A
  • Source:Carnobacterium maltaromaticum
  • Mass:5052.8 Da
  • Sequence Length:53 aa
  • Isoelectric Point:8.78
  • Activity:Antibacterial
  • Sequence
        DQMSDGVNYGKGSSLSKGGAKCGLGIVGGLATIPSGPLGWLAGAAGVINSCMK
  • Function:Has antibacterial activity.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A08829|    From 19 To 71 E-value: 7e-25 Score: 104
        DQMSDGVNYGKGSSLSKGGAKCGLGIVGGLATIPSGPLGWLAGAAGVINSCMK
  • 2. L01A003522    From 1 To 53 E-value: 2e-24 Score: 102
        DQMSDGVNYGKGSSLSKGGAKCGLGIVGGLATIPSGPLGWLAGAAGVINSCMK
  • 3. L12A08958|    From 22 To 70 E-value: 0.00000002 Score: 49.7
        HRMPNELN--RPNNLSKGGAKCGAAIAGGLFGIPKGPLAWAAGLANVYSKC
  • 4. L04ABAC101    From 4 To 52 E-value: 0.00000002 Score: 49.3
        HRMPNELN--RPNNLSKGGAKCGAAIAGGLFGIPKGPLAWAAGLANVYSKC
  • 5. L01A002785    From 17 To 52 E-value: 0.0000003 Score: 45.4
        SKGGAKCGAAIAGGLFGIPKGPLAWAAGLANVYSKC

Structure

  •   Domains
  •   1  Name:Bacteriocin_signal_motif    Interpro Link:IPR010133
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Vederas J.C.,Roy K.L.,Sailer M.,Henkel T.,Worobo R.W.,
  •   Title:Characteristics and genetic determinant of a hydrophobic peptide bacteriocin, carnobacteriocin A, produced by Carnobacterium piscicola LV17A.
  •   Journal:Microbiology, 1994, 140, 517-526  [MEDLINE:94282297]
  •   [2]  Schillinger U.,Axelsson L.,Holck A.L.,
  •   Title:Purification and cloning of piscicolin 61, a bacteriocin from Carnobacterium piscicola LV61.
  •   Journal:Curr. Microbiol., 1994, 29, 63-68  [MEDLINE:94297487]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: