Record in detail


General Info

  • lamp_id:L01A003540
  • Name:DEFBL_ORNAN
  • FullName:Defensin-BvL
  • Source:Ornithorhynchus anatinus
  • Mass:5217 Da
  • Sequence Length:46 aa
  • Isoelectric Point:11.5
  • Activity:Antimicrobial
  • Sequence
        EVRRRRRRPPCEDVNGQCQPRGNPCLRLRGACPRGSRCCMPTVAAH
  • Function:Has antimicrobial activity (By similarity).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003540    From 1 To 46 E-value: 7e-21 Score: 90.9
        EVRRRRRRPPCEDVNGQCQPRGNPCLRLRGACPRGSRCCMPTVAAH
  • 2. L11A005358    From 1 To 40 E-value: 5e-18 Score: 81.6
        RRPPCEDVNGQCQPRGNPCLRLRGACPRGSRCCMPTVAAH
  • 3. L13A023723    From 7 To 44 E-value: 4e-17 Score: 78.6
        PPCEDVNGQCQPRGNPCLRLRGACPRGSRCCMPTVAAH
  • 4. L12A03233|    From 4 To 35 E-value: 0.62 Score: 24.6
        CWFLKGHCKQNCKPSEQVKKPCKNGDYCCMPS
  • 5. L05ADEF164    From 26 To 58 E-value: 1.6 Score: 23.5
        RRFLCKKMNGQCEAECFTFEQKIGTCQANFLCC

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Wong E.S.,Torres A.M.,Bansal P.,Papenfuss A.T.,Whittington C.M.,
  •   Title:Defensins and the convergent evolution of platypus and reptile venom genes.
  •   Journal:Genome Res., 2008, 18, 986-994  [PubMed:18463304]
  •   [2]  Belov K.,Kuchel P.W.,Papenfuss A.T.,Whittington C.M.,
  •   Title:Expression patterns of platypus defensin and related venom genes across a range of tissue types reveal the possibility of broader functions for OvDLPs than previously suspected.
  •   Journal:Toxicon, 2008, 52, 559-565  [PubMed:18662710]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: