Record in detail


General Info

  • lamp_id:L01A003541
  • Name:DEFB6_ORNAN
  • FullName:Defensin-B6
  • Source:Ornithorhynchus anatinus
  • Mass:6638.5 Da
  • Sequence Length:57 aa
  • Isoelectric Point:8.92
  • Activity:Antimicrobial
  • Sequence
        KMEILLGSNGGARCDINKKSFDCYHRNGRCRFNCRKREYNNGDCSQYQSCCLPTRNL
  • Function:Has antimicrobial activity (By similarity).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003541    From 1 To 57 E-value: 6e-29 Score: 117
        KMEILLGSNGGARCDINKKSFDCYHRNGRCRFNCRKREYNNGDCSQYQSCCLPTRNL
  • 2. L12A00766|    From 7 To 41 E-value: 0.0001 Score: 37
        CWHKSGYCRKTCKADEVIKTACQHYQVCCVPAQKF
  • 3. L12A05597|    From 20 To 53 E-value: 0.0003 Score: 35.8
        CWHKSGYCRKTCKADEVIKTACQHYQVCCVPAQK
  • 4. L12A08039|    From 21 To 56 E-value: 0.0004 Score: 35
        KSLRCMATIGTCRHSCKKNEHPYYHCRDYQTCCLPS
  • 5. L12A11819|    From 5 To 40 E-value: 0.0006 Score: 34.7
        KSLRCMATIGTCRHSCKKNEHPYYHCRDYQTCCLPS

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Wong E.S.,Torres A.M.,Bansal P.,Papenfuss A.T.,Whittington C.M.,
  •   Title:Defensins and the convergent evolution of platypus and reptile venom genes.
  •   Journal:Genome Res., 2008, 18, 986-994  [PubMed:18463304]
  •   [2]  Belov K.,Kuchel P.W.,Papenfuss A.T.,Whittington C.M.,
  •   Title:Expression patterns of platypus defensin and related venom genes across a range of tissue types reveal the possibility of broader functions for OvDLPs than previously suspected.
  •   Journal:Toxicon, 2008, 52, 559-565  [PubMed:18662710]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: