Record in detail


General Info

  • lamp_id:L01A003542
  • Name:DEFB4_ORNAN
  • FullName:Defensin-B4
  • Source:Ornithorhynchus anatinus
  • Mass:7636.5 Da
  • Sequence Length:72 aa
  • Isoelectric Point:5.04
  • Activity:Antimicrobial
  • Sequence
        CKGKLGYCRSKCQSKQVELGKCSTKAICCGISTGTSSSQGSHEVPVINSEPALESKPEPQDTQEEEATMVSE
  • Function:Has antimicrobial activity (By similarity).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003542    From 1 To 72 E-value: 1e-36 Score: 143
        CKGKLGYCRSKCQSKQVELGKCSTKAICCGISTGTSSSQGSHEVPVINSEPALESKPEPQDTQEEEATMVSE
  • 2. L12A08357|    From 37 To 71 E-value: 0.004 Score: 32
        CENNEGFCRKKCKAEEVELRYCLSGKMCC-ISTYST
  • 3. L12A01041|    From 5 To 46 E-value: 0.006 Score: 31.6
        CRNKLGTCRKHCKYGEAIKEVCKNHRICC-ISASKSHSQGAFD
  • 4. L05ADEF299    From 25 To 65 E-value: 0.024 Score: 29.3
        CRIRGGFCRVGSCRFPHIAIGKCATFISCCG---------RAYEVDALNS
  • 5. L12A09283|    From 3 To 31 E-value: 0.026 Score: 29.3
        CWGKLGRCRATCEKNEVFHILCTNEAKCC

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Wong E.S.,Torres A.M.,Bansal P.,Papenfuss A.T.,Whittington C.M.,
  •   Title:Defensins and the convergent evolution of platypus and reptile venom genes.
  •   Journal:Genome Res., 2008, 18, 986-994  [PubMed:18463304]
  •   [2]  Belov K.,Kuchel P.W.,Papenfuss A.T.,Whittington C.M.,
  •   Title:Expression patterns of platypus defensin and related venom genes across a range of tissue types reveal the possibility of broader functions for OvDLPs than previously suspected.
  •   Journal:Toxicon, 2008, 52, 559-565  [PubMed:18662710]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: