Record in detail


General Info

  • lamp_id:L01A003557
  • Name:PEN3J_LITVA
  • FullName:Penaeidin-3j
  • Source:Litopenaeus vannamei
  • Mass:6528.5 Da
  • Sequence Length:61 aa
  • Isoelectric Point:10.05
  • Activity:Antibacterial, Antifungal
  • Sequence
        QVYKGGYTRPVPRPPFVRPLPGGPIGPYNGCPVSCRGISFSQARSCCSRLGRCCHVGKGYS
  • Function:Antibacterial and antifungal activity. Presents chitin-binding activity (By similarity).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A09144|    From 20 To 80 E-value: 5e-30 Score: 121
        QVYKGGYTRPVPRPPFVRPLPGGPIGPYNGCPVSCRGISFSQARSCCSRLGRCCHVGKGYS
  • 2. L12A09142|    From 20 To 80 E-value: 1e-29 Score: 119
        QVYKGGYTRPVPRPPFVRPLPGGPIDPYNGCPVSCRGISFSQARSCCSRLGRCCHVGKGYS
  • 3. L01A003557    From 1 To 61 E-value: 1e-29 Score: 119
        QVYKGGYTRPVPRPPFVRPLPGGPIGPYNGCPVSCRGISFSQARSCCSRLGRCCHVGKGYS
  • 4. L01A002496    From 20 To 78 E-value: 6e-29 Score: 117
        QVYKGGYTRPVPRPPFVRPLPGGPIGPYNGCPVSCRGISFSQARSCCSRLGRCCHVGKG
  • 5. L03A000269    From 20 To 81 E-value: 2e-28 Score: 116
        QVYKGGYTRPIPRPPPFVRPLPGGPIGPYNGCPVSCRGISFSQARSCCSRLGRCCHVGKGYS

Structure

  •   Domains
  •   1  Name:Penaeidin    Interpro Link:IPR009226
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Gross P.S.,Chapman R.W.,Shepard E.F.,Cuthbertson B.J.,
  •   Title:Diversity of the penaeidin antimicrobial peptides in two shrimp species.
  •   Journal:Immunogenetics, 2002, 54, 442-445  [MEDLINE:22226701]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: