Record in detail


General Info

  • lamp_id:L01A003576
  • Name:D108A_HUMAN
  • FullName:Putative beta-defensin 108A
  • Source:Homo sapiens
  • Mass:5843.7 Da
  • Sequence Length:51 aa
  • Isoelectric Point:8.13
  • Activity:Antibacterial
  • Sequence
        KFKEICERPNGSCRDFCLETEIHVGRCLNSRPCCLPLGHQPRIESTTPKKD
  • Function:Has antibacterial activity (Potential).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003576    From 1 To 51 E-value: 2e-25 Score: 105
        KFKEICERPNGSCRDFCLETEIHVGRCLNSRPCCLPLGHQPRIESTTPKKD
  • 2. L12A08188|    From 33 To 83 E-value: 2e-25 Score: 105
        KFKEICERPNGSCRDFCLETEIHVGRCLNSRPCCLPLGHQPRIESTTLKKD
  • 3. L12A05005|    From 1 To 51 E-value: 5e-25 Score: 104
        KFKEICERPNGSCRDFCLETEIHLGRCLNSRPCCLPLGHQPRIESTTPKKD
  • 4. L01A003487    From 1 To 51 E-value: 5e-25 Score: 104
        KFKEICERPNGSCRDFCLETEIHVGRCLNSQPCCLPLGHQPRIESTTPKKD
  • 5. L12A00509|    From 4 To 54 E-value: 5e-25 Score: 104
        KFKEICERPDGSCRDFCLETEIHVGRCLNSRPCCLPLGHQPRIESTTPKKD

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Dorin J.R.,Rolfe M.,Semple C.A.M.,
  •   Title:Duplication and selection in the evolution of primate beta-defensin genes.
  •   Journal:Genome Biol., 2003, 4, 0-0  [MEDLINE:22619651]
  •   [2]  Taudien S.,Asakawa S.,Zody M.C.,Mikkelsen T.S.,Nusbaum C.,
  •   Title:DNA sequence and analysis of human chromosome 8.
  •   Journal:Nature, 2006, 439, 331-335  [PubMed:16421571]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: