Record in detail


General Info

  • lamp_id:L01A003578
  • Name:WAP2_PHIOL
  • FullName:Waprin-Phi2
  • Source:Philodryas olfersii
  • Mass:5542.4 Da
  • Sequence Length:52 aa
  • Isoelectric Point:7.6
  • Activity:Antibacterial
  • Sequence
        EQEKPGSCPNVDMPIPPLGLCKTTCSKDSDCSETKKCCKNGCGFMTCTTARP
  • Function:Damages membranes of susceptible bacteria. Has no hemolytic activity. Not toxic to mice. Does not inhibit the proteinases elastase and cathepsin G (By similarity).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003578    From 1 To 52 E-value: 5e-25 Score: 104
        EQEKPGSCPNVDMPIPPLGLCKTTCSKDSDCSETKKCCKNGCGFMTCTTARP
  • 2. L01A003582    From 4 To 51 E-value: 2e-18 Score: 82.8
        RPGSCPNVDVPIPPLGLCRTTCQTDANCQEGRKCCKNGCGFMTCETAR
  • 3. L01A003633    From 1 To 51 E-value: 0.000000000000001 Score: 73.6
        NEKSGSCPDMSMPIPPLGICKTLCNSDSGCPNVQKCCKNGCGFMTCTTPVP
  • 4. L01A003579    From 1 To 51 E-value: 0.000000000000004 Score: 71.6
        ENEKAGSCPDVNQPIPPLGLCRNMCESDSGCPNNEKCCKNGCGFMTCSRPR
  • 5. L01A003580    From 1 To 48 E-value: 0.00000000000004 Score: 68.6
        QDGKAGSCPDVNQPIPPLGVCKTTCATDSNCPDIQKCCKNGCGHMSCT

Structure

  •   Domains
  •   1  Name:4-disulphide_core    Interpro Link:IPR015874
  •   2  Name:Whey_acidic_protein_4-diS_core    Interpro Link:IPR008197
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  McNaughtan J.,Young B.,van der Weerd L.,Scheib H.,Fry B.G.,
  •   Title:Evolution of an arsenal: structural and functional diversification of the venom system in the advanced snakes (Caenophidia).
  •   Journal:Mol. Cell. Proteomics, 2008, 7, 215-246  [PubMed:17855442]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: