Record in detail


General Info

  • lamp_id:L01A003580
  • Name:WAP1_RHATT
  • FullName:Waprin-Rha1
  • Source:Rhabdophis tigrinus tigrinus
  • Mass:5369.1 Da
  • Sequence Length:52 aa
  • Isoelectric Point:7.64
  • Activity:Antibacterial
  • Sequence
        QDGKAGSCPDVNQPIPPLGVCKTTCATDSNCPDIQKCCKNGCGHMSCTRPST
  • Function:Damages membranes of susceptible bacteria. Has no hemolytic activity. Not toxic to mice. Does not inhibit the proteinases elastase and cathepsin G (By similarity).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003580    From 1 To 52 E-value: 4e-25 Score: 105
        QDGKAGSCPDVNQPIPPLGVCKTTCATDSNCPDIQKCCKNGCGHMSCTRPST
  • 2. L01A003579    From 1 To 50 E-value: 9e-17 Score: 77.4
        ENEKAGSCPDVNQPIPPLGLCRNMCESDSGCPNNEKCCKNGCGFMTCSRP
  • 3. L01A003633    From 3 To 49 E-value: 7e-16 Score: 74.3
        KSGSCPDMSMPIPPLGICKTLCNSDSGCPNVQKCCKNGCGFMTCTTP
  • 4. L01A003578    From 1 To 48 E-value: 0.00000000000004 Score: 68.6
        EQEKPGSCPNVDMPIPPLGLCKTTCSKDSDCSETKKCCKNGCGFMTCT
  • 5. L01A003582    From 1 To 47 E-value: 0.0000000000002 Score: 65.9
        QVVRPGSCPNVDVPIPPLGLCRTTCQTDANCQEGRKCCKNGCGFMTC

Structure

  •   Domains
  •   1  Name:Whey_acidic_protein_4-diS_core    Interpro Link:IPR008197
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  McNaughtan J.,Young B.,van der Weerd L.,Scheib H.,Fry B.G.,
  •   Title:Evolution of an arsenal: structural and functional diversification of the venom system in the advanced snakes (Caenophidia).
  •   Journal:Mol. Cell. Proteomics, 2008, 7, 215-246  [PubMed:17855442]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: