Record in detail


General Info

  • lamp_id:L01A003583
  • Name:WAP1_ENHPO
  • FullName:Waprin-Enh1
  • Source:Enhydris polylepis
  • Mass:10783.5 Da
  • Sequence Length:94 aa
  • Isoelectric Point:8.74
  • Activity:Antibacterial
  • Sequence
        KILFGCGISPGNPFPCSLPGLTGNRCRRDYDCPQTLRCCNFRCSRSCRIPPVLPWSCPRNPFKCTIPGIDRCRYDYDCPGRQRCCYYSCSRICK
  • Function:Damages membranes of susceptible bacteria. Has no hemolytic activity. Not toxic to mice. Does not inhibit the proteinases elastase and cathepsin G (By similarity).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003583    From 1 To 94 E-value: 0 Score: 182
        KILFGCGISPGNPFPCSLPGLTGNRCRRDYDCPQTLRCCNFRCSRSCRIPPVLPWSCPRNPFKCTIPGIDRCRYDYDCPGRQRCCYYSCSRICK
  • 2. L01A003577    From 1 To 52 E-value: 0.0004 Score: 35
        KTTKQLRLPKVKPGECPKVKIPPDYPCNQYCVWDFDCEGNKKCCPVGCAKEC
  • 3. L01A003577    From 31 To 55 E-value: 4.7 Score: 21.6
        CVWDFDCEGNKKCCPVGCAKECFPP
  • 4. L13A022979    From 4 To 44 E-value: 0.003 Score: 32.3
        PKKPGLCPPRPQK---PCVKECKNDWSCPGQQKCCNYGCIDECR
  • 5. L13A022979    From 21 To 46 E-value: 0.069 Score: 27.7
        ECKNDWSCPGQQKCCNYGCIDECRDP

Structure

  •   Domains
  •   1  Name:Whey_acidic_protein_4-diS_core    Interpro Link:IPR008197
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  McNaughtan J.,Young B.,van der Weerd L.,Scheib H.,Fry B.G.,
  •   Title:Evolution of an arsenal: structural and functional diversification of the venom system in the advanced snakes (Caenophidia).
  •   Journal:Mol. Cell. Proteomics, 2008, 7, 215-246  [PubMed:17855442]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: