Record in detail


General Info

  • lamp_id:L01A003593
  • Name:WFD12_CALJA
  • FullName:WAP four-disulfide core domain protein 12
  • Source:Callithrix jacchus
  • Mass:9754.1 Da
  • Sequence Length:88 aa
  • Isoelectric Point:7.1
  • Activity:Antibacterial
  • Sequence
        VKVNIEKPGVCPADNIRCIKSDPPQCHTDQDCQGIRKCCYLHCGFKCVIPVKELEEGGNKDEDVSRPCPEPGWEAKPPGVFSTRCPQK
  • Function:Antibacterial protein. Putative acid-stable proteinase inhibitor (By similarity).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003593    From 1 To 88 E-value: 0 Score: 178
        VKVNIEKPGVCPADNIRCIKSDPPQCHTDQDCQGIRKCCYLHCGFKCVIPVKELEEGGNKDEDVSRPCPEPGWEAKPPGVFSTRCPQK
  • 2. L01A003584    From 1 To 88 E-value: 8.96831e-44 Score: 167
        VKGNTEKPGVCPADNVRCIKSDPPQCHTDQDCQGIRKCCYLHCGFKCVIPVKELEEGGSKDEDVSRPCPESGWEVKPPGFFSTRCPQK
  • 3. L01A003587    From 1 To 88 E-value: 6e-40 Score: 154
        VKEDIEKAGVCPADNVRCFKSDPPQCHTDQDCLGERKCCYLHCGFKCVIPVKELEEGGNKDEDVSRPYPEPGWEAKCPGSSSTRCPQK
  • 4. L01A003637    From 1 To 88 E-value: 8e-40 Score: 153
        VKEGIEKAGVCPADNVRCFKSDPPQCHTDQDCLGERKCCYLHCGFKCVIPVKELEEGGNKDEDVSRPYPEPGWEAKCPGSSSTRCPQK
  • 5. L01A003586    From 1 To 88 E-value: 2e-39 Score: 152
        VKGGIEKAGVCPADNVRCFKSDPPQCHTDQDCLGARKCCYLHCGFKCVIPVKKLEEGGNKDEDVSGPCPEPGWEAKSPGSSSTGCPQK

Structure

  •   Domains
  •   1  Name:4-disulphide_core    Interpro Link:IPR015874
  •   2  Name:Whey_acidic_protein_4-diS_core    Interpro Link:IPR008197
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Green E.D.,Swanson W.,Hurle B.,
  •   Title:Comparative sequence analyses reveal rapid and divergent evolutionary changes of the WFDC locus in the primate lineage.
  •   Journal:Genome Res., 2007, 17, 276-286  [PubMed:17267810]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: