Record in detail


General Info

  • lamp_id:L01A003594
  • Name:WFD12_AOTNA
  • FullName:WAP four-disulfide core domain protein 12
  • Source:Aotus nancymaae
  • Mass:7673.7 Da
  • Sequence Length:69 aa
  • Isoelectric Point:5.04
  • Activity:Antibacterial
  • Sequence
        VKGNIEKPEVCPADNVRCIKSDPPQCHTDQDCQGIRKCCYLHCGFKCVIPVKELEEGGNQDEDVSRPCP
  • Function:Antibacterial protein. Putative acid-stable proteinase inhibitor (By similarity).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003594    From 1 To 69 E-value: 1e-35 Score: 139
        VKGNIEKPEVCPADNVRCIKSDPPQCHTDQDCQGIRKCCYLHCGFKCVIPVKELEEGGNQDEDVSRPCP
  • 2. L01A003584    From 1 To 69 E-value: 1e-33 Score: 133
        VKGNTEKPGVCPADNVRCIKSDPPQCHTDQDCQGIRKCCYLHCGFKCVIPVKELEEGGSKDEDVSRPCP
  • 3. L01A003593    From 1 To 69 E-value: 2e-33 Score: 132
        VKVNIEKPGVCPADNIRCIKSDPPQCHTDQDCQGIRKCCYLHCGFKCVIPVKELEEGGNKDEDVSRPCP
  • 4. L01A003586    From 1 To 69 E-value: 8e-31 Score: 124
        VKGGIEKAGVCPADNVRCFKSDPPQCHTDQDCLGARKCCYLHCGFKCVIPVKKLEEGGNKDEDVSGPCP
  • 5. L01A003592    From 1 To 69 E-value: 2e-30 Score: 122
        VKGGIEKAGVCPADNVRCFKSDPPQCHTDQDCLGERKCCYLHCGFKCVIPVKKLEEGGNKDEDVSGPCP

Structure

  •   Domains
  •   1  Name:4-disulphide_core    Interpro Link:IPR015874
  •   2  Name:Whey_acidic_protein_4-diS_core    Interpro Link:IPR008197
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Green E.D.,Swanson W.,Hurle B.,
  •   Title:Comparative sequence analyses reveal rapid and divergent evolutionary changes of the WFDC locus in the primate lineage.
  •   Journal:Genome Res., 2007, 17, 276-286  [PubMed:17267810]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: