Record in detail


General Info

  • lamp_id:L01A003600
  • Name:DEFB9_RAT
  • FullName:Beta-defensin 9
  • Source:Rattus norvegicus
  • Mass:5773.7 Da
  • Sequence Length:48 aa
  • Isoelectric Point:8.84
  • Activity:Antibacterial
  • Sequence
        ELKHLGLKTEFEQCQRIRGYCLNTYCRFPTSHVGSCYPEKRYCCKNIR
  • Function:Has antibacterial activity (By similarity).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003600    From 1 To 48 E-value: 7e-24 Score: 100
        ELKHLGLKTEFEQCQRIRGYCLNTYCRFPTSHVGSCYPEKRYCCKNIR
  • 2. L01A003678    From 1 To 48 E-value: 0.000000000009 Score: 60.8
        ELKHLGMTAETEWCRLFEGFCHDKNCPPPTSHVGSCHPEKRSCCKDRR
  • 3. L05ADEF162    From 24 To 71 E-value: 0.0000004 Score: 45.4
        DLKHLILKAQLARCYKFGGFCYNSMCPPHTKFIGNCHPDHLHCCINMK
  • 4. L01A002495    From 1 To 48 E-value: 0.0000004 Score: 45.4
        DLKHLILKAQLARCYKFGGFCYNSMCPPHTKFIGNCHPDHLHCCINMK
  • 5. L05ADEF378    From 25 To 68 E-value: 0.000001 Score: 43.9
        LGPLRIQTDYHRCLREKGFCLNAVCPRSTLFVGTCFPYKFYCCK

Structure

  •   Domains
  •   1  Name:Defensin_beta-typ    Interpro Link:IPR001855
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Zhang G.,Blecha F.,Sang Y.,Cai Y.,Patil A.A.,
  •   Title:Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract.
  •   Journal:Physiol. Genomics, 2005, 23, 5-17  [PubMed:16033865]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: