Record in detail
General Info
- lamp_id:L01A003606
- Name:DFB38_RAT
- FullName:Beta-defensin 38
- Source:Rattus norvegicus
- Mass:4918.7 Da
- Sequence Length:42 aa
- Isoelectric Point:8.83
- Activity:Antibacterial
- Sequence
TDQDTAKCVQKKNVCYYFECPWLSISVSTCYKGKAKCCQKRY - Function:Has antibacterial activity (By similarity).
Cross-Linking
- Cross-linking
- 1 Database:CAMP CAMPSQ2008
- 2 Database:dbAMP dbAMP_11402
- 3 Database:DRAMP DRAMP03448
- 4 Database:Uniprot Q32ZF8
- 5 Database:DEF DEF323
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L01A003606 From 1 To 42 E-value: 1e-19 Score: 87
TDQDTAKCVQKKNVCYYFECPWLSISVSTCYKGKAKCCQKRY - 2. L12A07933| From 25 To 63 E-value: 0.00000000000003 Score: 68.9
DTKKCVQRKNACHYFECPWLYYSVGTCYKGKGKCCQKRY - 3. L01A000632 From 4 To 42 E-value: 0.00000000000005 Score: 68.2
DTKKCVQRKNACHYFECPWLYYSVGTCYKGKGKCCQKRY - 4. L03A000152 From 25 To 62 E-value: 0.0000000009 Score: 53.9
DTIKCLQGNNNCHIQKCPWFLLQVSTCYKGKGRCCQKR - 5. L05ADEF342 From 25 To 62 E-value: 0.000000001 Score: 53.9
DTMKCVRGKNNCHMHRCPWFFVLISTCYSGKGSCCQKR
Structure
- Domains
- 1 Name:Defensin_beta-typ Interpro Link:IPR001855
- Structures
No structs found on LAMP database
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] Zhang G.,Blecha F.,Sang Y.,Cai Y.,Patil A.A.,
- Title:Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract.
- Journal:Physiol. Genomics, 2005, 23, 5-17 [PubMed:16033865]
Comments
- Comments
No comments found on LAMP database