Record in detail


General Info

  • lamp_id:L01A003607
  • Name:DFB39_RAT
  • FullName:Beta-defensin 39
  • Source:Rattus norvegicus
  • Mass:5822.8 Da
  • Sequence Length:50 aa
  • Isoelectric Point:9.47
  • Activity:Antibacterial
  • Sequence
        IDSVKCFQKNNTCHTIRCPYFQDEVGTCYEGRGKCCQKRLLSIRVPKKKV
  • Function:Has antibacterial activity (By similarity).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003607    From 1 To 50 E-value: 6e-25 Score: 104
        IDSVKCFQKNNTCHTIRCPYFQDEVGTCYEGRGKCCQKRLLSIRVPKKKV
  • 2. L05ADEF191    From 25 To 72 E-value: 4e-20 Score: 88.6
        DSIQCFQKNNTCHTNQCPYFQDEIGTCYDKRGKCCQKRLLHIRVPRKK
  • 3. L01A002611    From 2 To 49 E-value: 6e-20 Score: 87.8
        DSIQCFQKNNTCHTNQCPYFQDEIGTCYDKRGKCCQKRLLHIRVPRKK
  • 4. L01A002457    From 1 To 36 E-value: 0.00000000000005 Score: 68.2
        DSIQCFQKNNTCHTNQCPYFQDEIGTCYDRRGKCCQ
  • 5. L03A000152    From 24 To 62 E-value: 0.00000000005 Score: 58.2
        LDTIKCLQGNNNCHIQKCPWFLLQVSTCYKGKGRCCQKR

Structure

  •   Domains
  •   1  Name:Defensin_beta-typ    Interpro Link:IPR001855
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Zhang G.,Blecha F.,Sang Y.,Cai Y.,Patil A.A.,
  •   Title:Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract.
  •   Journal:Physiol. Genomics, 2005, 23, 5-17  [PubMed:16033865]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: