Record in detail


General Info

  • lamp_id:L01A003608
  • Name:DFB43_RAT
  • FullName:Beta-defensin 43
  • Source:Rattus norvegicus
  • Mass:5954 Da
  • Sequence Length:48 aa
  • Isoelectric Point:9.41
  • Activity:Antibacterial
  • Sequence
        FLANQECFSEYRHCRMKCKANEYAIRYCADWTICCRVKKREAKKKIMW
  • Function:Has bactericidal activity (By similarity).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003608    From 1 To 48 E-value: 2e-23 Score: 99.4
        FLANQECFSEYRHCRMKCKANEYAIRYCADWTICCRVKKREAKKKIMW
  • 2. L01A003613    From 1 To 47 E-value: 0.0000000000001 Score: 66.6
        FLENQDC-SKHRHCRMKCKANEYAVRYCEDWTICCRVKKKESKKKKMW
  • 3. L12A00539|    From 4 To 51 E-value: 0.000000000003 Score: 62
        FISNDECPSEYYHCRLKCNADEHAIRYCADFSICCKLKIIEIDGQKKW
  • 4. L01A003518    From 1 To 48 E-value: 0.000000000003 Score: 62
        FISNDECPSEYYHCRLKCNADEHAIRYCADFSICCKLKIIEIDGQKKW
  • 5. L12A02367|    From 1 To 48 E-value: 0.00000000002 Score: 59.7
        FTSNDECPSEYYHCRLKCNADEHAIRYCADFSICCKLKIIQIDGQKKW

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Zhang G.,Blecha F.,Sang Y.,Cai Y.,Patil A.A.,
  •   Title:Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract.
  •   Journal:Physiol. Genomics, 2005, 23, 5-17  [PubMed:16033865]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: