Record in detail


General Info

  • lamp_id:L01A003609
  • Name:DFB20_MOUSE
  • FullName:Beta-defensin 20
  • Source:Mus musculus
  • Mass:8804.3 Da
  • Sequence Length:75 aa
  • Isoelectric Point:8.81
  • Activity:Antibacterial
  • Sequence
        KRCFSNVEGYCRKKCRLVEISEMGCLHGKYCCVNELENKKHKKHSVVEETVKLQDKSKVQDYMILPTVTYYTISI
  • Function:Has antibacterial activity (By similarity).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003609    From 1 To 75 E-value: 1e-39 Score: 153
        KRCFSNVEGYCRKKCRLVEISEMGCLHGKYCCVNELENKKHKKHSVVEETVKLQDKSKVQDYMILPTVTYYTISI
  • 2. L01A003601    From 1 To 75 E-value: 7e-34 Score: 134
        KRCFSNVAGYCRKRCRLVEISEMGCLHGKYCCVNELENKRHKKDTVVEQPMEPRDKSKVQDYMVLPTITYYTITI
  • 3. L13A016308    From 1 To 50 E-value: 2e-24 Score: 102
        KRCFSNVEGYCRKKCRLVEISEMGCLHGKYCCVNELENKKHKKHSVVEET
  • 4. L12A00534|    From 4 To 76 E-value: 5e-19 Score: 84.7
        RKCFSNITGYCRKKCKMGEIYEMACLNGKLCCVNEDKNKKHQKAP--ESPLPLPQPKGKI-DYVILPTITLLTIQL
  • 5. L12A09164|    From 4 To 77 E-value: 1e-18 Score: 83.2
        KKCFSNVTGFCRKRCKLGETSDKGCLRGKFCCVNLEENKKYKKAPEVPDEHFTQNEKDKVEEVVILPTVTLITI

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Zhang G.,Blecha F.,Sang Y.,Cai Y.,Patil A.A.,
  •   Title:Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract.
  •   Journal:Physiol. Genomics, 2005, 23, 5-17  [PubMed:16033865]
  •   [2]  Frith M.C.,Gough J.,Katayama S.,Kasukawa T.,Carninci P.,
  •   Title:The transcriptional landscape of the mammalian genome.
  •   Journal:Science, 2005, 309, 1559-1563  [PubMed:16141072]
  •   [3]  Goldstein S.,Zody M.C.,Hillier L.W.,Goodstadt L.,Church D.M.,
  •   Title:Lineage-specific biology revealed by a finished genome assembly of the mouse.
  •   Journal:PLoS Biol., 2009, 7, 0-0  [PubMed:19468303]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: