Record in detail


General Info

  • lamp_id:L01A003610
  • Name:DFB25_MOUSE
  • FullName:Beta-defensin 25
  • Source:Mus musculus
  • Mass:5620.4 Da
  • Sequence Length:49 aa
  • Isoelectric Point:8.39
  • Activity:Antibacterial
  • Sequence
        EFKRCWNGQGACRTFCTRQETFMHLCPDASLCCLSYSFKPSRPSRVGDV
  • Function:Has antibacterial activity (By similarity).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003610    From 1 To 49 E-value: 4e-25 Score: 105
        EFKRCWNGQGACRTFCTRQETFMHLCPDASLCCLSYSFKPSRPSRVGDV
  • 2. L01A003602    From 1 To 49 E-value: 1e-19 Score: 87
        EFKRCWNGQGACRTYCTRQEKFIHLCPDASLCCLSYSLKASPHSRAGGV
  • 3. L12A01357|    From 1 To 48 E-value: 3e-19 Score: 85.1
        EFKRCWKGQGSCRTYCMRQESFMHLCPDASLCCLAYSFQPTRPPKPDD
  • 4. L12A04037|    From 4 To 51 E-value: 1e-18 Score: 83.6
        EFKRCWKGQGTCRTYCTRQESFIHLCPDASLCCLSYMFRPSRPPMPED
  • 5. L12A01358|    From 1 To 43 E-value: 3e-18 Score: 82
        EFKRCWKGQGTCRTYCTKQESFIHLCPDASLCCLSYMFRPSRP

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  
  •   Title:The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
  •   Journal:Genome Res., 2004, 14, 2121-2127  [PubMed:15489334]
  •   [2]  Zhang G.,Blecha F.,Sang Y.,Cai Y.,Patil A.A.,
  •   Title:Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract.
  •   Journal:Physiol. Genomics, 2005, 23, 5-17  [PubMed:16033865]
  •   [3]  Goldstein S.,Zody M.C.,Hillier L.W.,Goodstadt L.,Church D.M.,
  •   Title:Lineage-specific biology revealed by a finished genome assembly of the mouse.
  •   Journal:PLoS Biol., 2009, 7, 0-0  [PubMed:19468303]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: