Record in detail


General Info

  • lamp_id:L01A003611
  • Name:DFB30_MOUSE
  • FullName:Beta-defensin 30
  • Source:Mus musculus
  • Mass:6318.6 Da
  • Sequence Length:53 aa
  • Isoelectric Point:8.61
  • Activity:Antibacterial
  • Sequence
        GVNMYIKRIYDTCWKLKGICRNTCQKEEIYHIFCGIQSLCCLEKKEMPVLFVK
  • Function:Has antibacterial activity (By similarity).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A09036|    From 24 To 76 E-value: 2e-27 Score: 112
        GVNMYIKRIYDTCWKLKGICRNTCQKEEIYHIFCGIQSLCCLEKKEMPVLFVK
  • 2. L01A003611    From 1 To 53 E-value: 8e-27 Score: 110
        GVNMYIKRIYDTCWKLKGICRNTCQKEEIYHIFCGIQSLCCLEKKEMPVLFVK
  • 3. L01A003604    From 1 To 53 E-value: 2e-21 Score: 92.4
        GVNMYIRQIYDTCWKLKGHCRNVCGKKEIFHIFCGTQFLCCIERKEMPVLFVK
  • 4. L12A04281|    From 1 To 52 E-value: 2e-19 Score: 86.3
        GVNMYIRQIYDTCWKLKGHCRNVCGKKEIFHIFCGTQFLCCIERKEMPV-FVK
  • 5. L12A10769|    From 3 To 55 E-value: 0.000000000000002 Score: 72.8
        GPNMYIRRLFSTCWRTKGVCKKSCGKSEIYHIFCDSAHLCCIDKKYLPVEFGK

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  
  •   Title:The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
  •   Journal:Genome Res., 2004, 14, 2121-2127  [PubMed:15489334]
  •   [2]  Zhang G.,Blecha F.,Sang Y.,Cai Y.,Patil A.A.,
  •   Title:Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract.
  •   Journal:Physiol. Genomics, 2005, 23, 5-17  [PubMed:16033865]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: