Record in detail


General Info

  • lamp_id:L01A003614
  • Name:DFB50_RAT
  • FullName:Beta-defensin 50
  • Source:Rattus norvegicus
  • Mass:5492.4 Da
  • Sequence Length:50 aa
  • Isoelectric Point:8.22
  • Activity:Antibacterial
  • Sequence
        HPGTVHVRFKCIPKIAAVFGDNCPFYGNVDGLCNDKKSVCCMVPVRLDNI
  • Function:Has bactericidal activity (By similarity).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003614    From 1 To 50 E-value: 7e-25 Score: 104
        HPGTVHVRFKCIPKIAAVFGDNCPFYGNVDGLCNDKKSVCCMVPVRLDNI
  • 2. L03A000175    From 24 To 73 E-value: 3e-18 Score: 82.4
        HPGTFHVRIKCMPKMTAVFGDNCSFYSSMGDLCNNTKSVCCMVPVRMDNI
  • 3. L01A003626    From 1 To 50 E-value: 4e-18 Score: 82
        HPGTFHVRIKCMPKMTAVFGDNCSFYSSMGDLCNNTKSVCCMVPVRMDNI
  • 4. L01A002611    From 5 To 37 E-value: 0.19 Score: 26.2
        QCFQKNNTCHTNQCPYFQDEIGTCYDKRGKCCQ
  • 5. L05ADEF191    From 28 To 60 E-value: 0.21 Score: 26.2
        QCFQKNNTCHTNQCPYFQDEIGTCYDKRGKCCQ

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  
  •   Title:The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
  •   Journal:Genome Res., 2004, 14, 2121-2127  [PubMed:15489334]
  •   [2]  Zhang G.,Blecha F.,Sang Y.,Cai Y.,Patil A.A.,
  •   Title:Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract.
  •   Journal:Physiol. Genomics, 2005, 23, 5-17  [PubMed:16033865]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: