Record in detail


General Info

  • lamp_id:L01A003617
  • Name:GLL11_CHICK
  • FullName:Gallinacin-11
  • Source:Gallus gallus
  • Mass:8922.3 Da
  • Sequence Length:79 aa
  • Isoelectric Point:8.3
  • Activity:Antibacterial
  • Sequence
        DTSRCVGYHGYCIRSKVCPKPFAAFGTCSWRQKTCCVDTTSDFHTCQDKGGHCVSPKIRCLEEQLGLCPLKRWTCCKEI
  • Function:Has bactericidal activity (By similarity).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L02A001613    From 4 To 82 E-value: 1.00053e-42 Score: 162
        DTSRCVGYHGYCIRSKVCPKPFAAFGTCSWRQKTCCVDTTSDFHTCQDKGGHCVSPKIRCLEEQLGLCPLKRWTCCKEI
  • 2. L01A003617    From 1 To 79 E-value: 1.00053e-42 Score: 162
        DTSRCVGYHGYCIRSKVCPKPFAAFGTCSWRQKTCCVDTTSDFHTCQDKGGHCVSPKIRCLEEQLGLCPLKRWTCCKEI
  • 3. L12A05946|    From 4 To 80 E-value: 1.99993e-41 Score: 159
        DTSRCVGYHGYCIRSKVCPKPFAAFGTCSWRQKTCCVDTTSDFHTCQDKGGHCVSPKIRCLEEQLGLCPLKRWTCCK
  • 4. L13A022146    From 4 To 50 E-value: 2e-23 Score: 99.4
        DTSRCVGYHGYCIRSKVCPKPFAAFGTCSWRQKTCCVDTTSDFHTCQ
  • 5. L01A002533    From 4 To 36 E-value: 0.012 Score: 30.4
        TCSKNGGFCISPKCLPGSKQIGTCSLPGSKCCK

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Doi Y.,Kim F.,Morimoto A.,Kido S.,
  •   Title:Isolation of a novel protein from the outer layer of the vitelline membrane.
  •   Journal:Biochem. J., 1992, 286, 17-22  [MEDLINE:92392273]
  •   [2]  Cheng J.-F.,Matsuda Y.,Ando J.,Hughes A.L.,Xiao Y.,
  •   Title:A genome-wide screen identifies a single beta-defensin gene cluster in the chicken: implications for the origin and evolution of mammalian defensins.
  •   Journal:BMC Genomics, 2004, 5, 56-56  [PubMed:15310403]
  •   [3]  Yoshimura Y.,Nishibori M.,Isobe N.,Subedi K.,
  •   Title:Changes in the expression of gallinacins, antimicrobial peptides, in ovarian follicles during follicular growth and in response to lipopolysaccharide in laying hens (Gallus domesticus).
  •   Journal:Reproduction, 2007, 133, 127-133  [PubMed:17244739]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: