Record in detail


General Info

  • lamp_id:L01A003618
  • Name:GLL13_CHICK
  • FullName:Gallinacin-13
  • Source:Gallus gallus
  • Mass:7450.3 Da
  • Sequence Length:66 aa
  • Isoelectric Point:8.65
  • Activity:Antibacterial
  • Sequence
        FSDSQLCRNNHGHCRRLCFHMESWAGSCMNGRLRCCRFSTKQPFSNPKHSVLHTAEQDPSPSLGGT
  • Function:Has bactericidal activity. Potent activity against E.coli, L.monocytogenes, S.typhimurium and S.pyogenes but mot against S.aureus.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A09037|    From 24 To 89 E-value: 4e-36 Score: 141
        FSDSQLCRNNHGHCRRLCFHMESWAGSCMNGRLRCCRFSTKQPFSNPKHSVLHTAEQDPSPSLGGT
  • 2. L01A003618    From 1 To 66 E-value: 2e-35 Score: 139
        FSDSQLCRNNHGHCRRLCFHMESWAGSCMNGRLRCCRFSTKQPFSNPKHSVLHTAEQDPSPSLGGT
  • 3. L13A023838    From 1 To 50 E-value: 2e-25 Score: 106
        FSDSQLCRNNHGHCRRLCFHMESWAGSCMNGRLRCCRFSTKQPFSNPKHS
  • 4. L12A09038|    From 25 To 61 E-value: 0.00000000000002 Score: 69.7
        LSDSQQCRSNHGHCRRLCFHMERWEGSCSNGRLRCCR
  • 5. L12A11152|    From 2 To 35 E-value: 0.000000000009 Score: 60.8
        LSDTQQCRNNRGHCRRLCFHMERWEGSCSNGRLR

Structure

  •   Domains
  •   1  Name:Defensin_beta-typ    Interpro Link:IPR001855
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Cheng J.-F.,Matsuda Y.,Ando J.,Hughes A.L.,Xiao Y.,
  •   Title:A genome-wide screen identifies a single beta-defensin gene cluster in the chicken: implications for the origin and evolution of mammalian defensins.
  •   Journal:BMC Genomics, 2004, 5, 56-56  [PubMed:15310403]
  •   [2]  Tierney J.,McMahon J.,Gaines S.,Lynn D.J.,Higgs R.,
  •   Title:The synthetic form of a novel chicken beta-defensin identified in silico is predominantly active against intestinal pathogens.
  •   Journal:Immunogenetics, 2005, 57, 90-98  [PubMed:15744537]
  •   [3]  Yoshimura Y.,Nishibori M.,Isobe N.,Subedi K.,
  •   Title:Changes in the expression of gallinacins, antimicrobial peptides, in ovarian follicles during follicular growth and in response to lipopolysaccharide in laying hens (Gallus domesticus).
  •   Journal:Reproduction, 2007, 133, 127-133  [PubMed:17244739]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: