Record in detail


General Info

  • lamp_id:L01A003619
  • Name:WF15A_MOUSE
  • FullName:WAP four-disulfide core domain protein 15A
  • Source:Mus musculus
  • Mass:6896.2 Da
  • Sequence Length:60 aa
  • Isoelectric Point:8.77
  • Activity:Antibacterial
  • Sequence
        QPRATRKGVTPKQGYCPEFLLDCPFVLLPVCSRDKGCKGTKKCCFYYCQMRCVEPWTTLT
  • Function:Antibacterial protein (By similarity).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003619    From 1 To 60 E-value: 9e-31 Score: 123
        QPRATRKGVTPKQGYCPEFLLDCPFVLLPVCSRDKGCKGTKKCCFYYCQMRCVEPWTTLT
  • 2. L12A08041|    From 21 To 78 E-value: 1e-17 Score: 80.5
        RPEIKKKNVFSKPGYCPEYRVPCPFVLIPKCRRDKGCKDALKCCFFYCQMRCVDPWES
  • 3. L01A003634    From 1 To 58 E-value: 2e-17 Score: 79.3
        RPEIKKKNVFSKPGYCPEYRVPCPFVLIPKCRRDKGCKDALKCCFFYCQMRCVDPWES
  • 4. L13A016921    From 1 To 50 E-value: 0.0000000000002 Score: 65.9
        RPEIKKKNVFSKPGYCPEYRVPCPFVLIPKCRRDKGCKDALKCCFFYCQM
  • 5. L01A003584    From 2 To 54 E-value: 0.000007 Score: 41.2
        KGNTEKPGVCPADNVRCIKSDPPQCHTDQDCQGIRKCCYLHCGFKCVIPVKEL

Structure

  •   Domains
  •   1  Name:4-disulphide_core    Interpro Link:IPR015874
  •   2  Name:Whey_acidic_protein_4-diS_core    Interpro Link:IPR008197
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  
  •   Title:The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
  •   Journal:Genome Res., 2004, 14, 2121-2127  [PubMed:15489334]
  •   [2]  Lundwall A.,Lilja H.,Clauss A.,
  •   Title:The evolution of a genetic locus encoding small serine proteinase inhibitors.
  •   Journal:Biochem. Biophys. Res. Commun., 2005, 333, 383-389  [PubMed:15950183]
  •   [3]  Frith M.C.,Gough J.,Katayama S.,Kasukawa T.,Carninci P.,
  •   Title:The transcriptional landscape of the mammalian genome.
  •   Journal:Science, 2005, 309, 1559-1563  [PubMed:16141072]
  •   [4]  Goldstein S.,Zody M.C.,Hillier L.W.,Goodstadt L.,Church D.M.,
  •   Title:Lineage-specific biology revealed by a finished genome assembly of the mouse.
  •   Journal:PLoS Biol., 2009, 7, 0-0  [PubMed:19468303]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: