Record in detail


General Info

  • lamp_id:L01A003626
  • Name:DFB50_MOUSE
  • FullName:Beta-defensin 50
  • Source:Mus musculus
  • Mass:5587.6 Da
  • Sequence Length:50 aa
  • Isoelectric Point:8.22
  • Activity:Antibacterial
  • Sequence
        HPGTFHVRIKCMPKMTAVFGDNCSFYSSMGDLCNNTKSVCCMVPVRMDNI
  • Function:Has bactericidal activity (By similarity).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000175    From 24 To 73 E-value: 6e-26 Score: 107
        HPGTFHVRIKCMPKMTAVFGDNCSFYSSMGDLCNNTKSVCCMVPVRMDNI
  • 2. L01A003626    From 1 To 50 E-value: 2e-25 Score: 105
        HPGTFHVRIKCMPKMTAVFGDNCSFYSSMGDLCNNTKSVCCMVPVRMDNI
  • 3. L01A003614    From 1 To 50 E-value: 4e-18 Score: 82
        HPGTVHVRFKCIPKIAAVFGDNCPFYGNVDGLCNDKKSVCCMVPVRLDNI
  • 4. L12A02303|    From 43 To 69 E-value: 2.6 Score: 22.7
        GTCCARCNCVPSGTAGNLDECPCYANM
  • 5. L06AT00250    From 30 To 56 E-value: 5.3 Score: 21.6
        GTCCARSRCVPPGTAGNQEMCPCYASL

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Dumpit R.,Ferguson C.,Clegg N.J.,Pritchard C.,Abbott D.E.,
  •   Title:Expressed sequence tag profiling identifies developmental and anatomic partitioning of gene expression in the mouse prostate.
  •   Journal:Genome Biol., 2003, 4, 0-0  [PubMed:14659016]
  •   [2]  Zhang G.,Blecha F.,Sang Y.,Cai Y.,Patil A.A.,
  •   Title:Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract.
  •   Journal:Physiol. Genomics, 2005, 23, 5-17  [PubMed:16033865]
  •   [3]  Goldstein S.,Zody M.C.,Hillier L.W.,Goodstadt L.,Church D.M.,
  •   Title:Lineage-specific biology revealed by a finished genome assembly of the mouse.
  •   Journal:PLoS Biol., 2009, 7, 0-0  [PubMed:19468303]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: