Record in detail


General Info

  • lamp_id:L01A003627
  • Name:TLP_PHAVU
  • FullName:Thaumatin-like protein
  • Source:Phaseolus vulgaris
  • Mass:3221.5 Da
  • Sequence Length:30 aa
  • Isoelectric Point:8.53
  • Activity:Antifungal
  • Sequence
        ANFEIVNNCPYTVWAAASPGGGRRLDRGQT
  • Function:Has antifungal activity against C.comatus, F.oxysporum and P.ostreatus.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003627    From 1 To 30 E-value: 0.0000000000003 Score: 65.5
        ANFEIVNNCPYTVWAAASPGGGRRLDRGQT
  • 2. L12A00654|    From 1 To 31 E-value: 0.000000005 Score: 51.6
        ATIEVRNNCPYTVWAASTPIGGGRRLDRGQT
  • 3. L13A020819    From 1 To 30 E-value: 0.00000002 Score: 49.3
        ATFTIRNNCPYTIWAAAVPGGGRRLNSGGT
  • 4. L12A00659|    From 1 To 31 E-value: 0.00000004 Score: 48.5
        ATIEVRNNXPYTVWAASTPIGGGRRLDRGQT
  • 5. L12A00649|    From 1 To 26 E-value: 0.00000009 Score: 47.4
        ATFTIRNNXPYTVWAAASPGGGRRLD

Structure

  •   Domains
  •   1  Name:Thaumatin    Interpro Link:IPR001938
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Ng T.B.,Wang H.X.,Ye X.Y.,
  •   Title:First chromatographic isolation of an antifungal thaumatin-like protein from French bean legumes and demonstration of its antifungal activity.
  •   Journal:Biochem. Biophys. Res. Commun., 1999, 263, 130-134  [PubMed:10486265]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: