Record in detail


General Info

  • lamp_id:L01A003630
  • Name:WFD12_RAT
  • FullName:WAP four-disulfide core domain protein 12
  • Source:Rattus norvegicus
  • Mass:6425.2 Da
  • Sequence Length:57 aa
  • Isoelectric Point:6.46
  • Activity:Antibacterial
  • Sequence
        GGVKGAEKGVCPPDNVRCIRGEDPQCHNDNDCKDQKICCYWHCGFKCVQPVKDSWEQ
  • Function:Antibacterial protein. Putative acid-stable proteinase inhibitor (By similarity).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003630    From 1 To 57 E-value: 6e-29 Score: 117
        GGVKGAEKGVCPPDNVRCIRGEDPQCHNDNDCKDQKICCYWHCGFKCVQPVKDSWEQ
  • 2. L12A09623|    From 22 To 78 E-value: 4e-21 Score: 91.7
        GGVKGEEKRVCPPDYVRCIRQDDPQCYSDNDCGDQEICCFWQCGFKCVLPVKDNSEE
  • 3. L01A003635    From 1 To 57 E-value: 2e-20 Score: 89.7
        GGVKGEEKRVCPPDYVRCIRQDDPQCYSDNDCGDQEICCFWQCGFKCVLPVKDNSEE
  • 4. L13A022919    From 1 To 50 E-value: 5e-18 Score: 81.6
        GGVKGEEKRVCPPDYVRCIRQDDPQCYSDNDCGDQEICCFWQCGFKCVLP
  • 5. L01A003585    From 3 To 56 E-value: 0.00000000000002 Score: 69.7
        KGIEKAGVCPADNVRCFKSDPPQCHTDQDCLGERKCCYLHCGFKCVIPVKELEE

Structure

  •   Domains
  •   1  Name:Whey_acidic_protein_4-diS_core    Interpro Link:IPR008197
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Lopez-Otin C.,Puente X.S.,
  •   Title:A genomic analysis of rat proteases and protease inhibitors.
  •   Journal:Genome Res., 2004, 14, 609-622  [PubMed:15060002]
  •   [2]  Sodergren E.J.,Muzny D.M.,Metzker M.L.,Weinstock G.M.,Gibbs R.A.,
  •   Title:Genome sequence of the Brown Norway rat yields insights into mammalian evolution.
  •   Journal:Nature, 2004, 428, 493-521  [PubMed:15057822]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: