Record in detail


General Info

  • lamp_id:L01A003637
  • Name:WFD12_HUMAN
  • FullName:WAP four-disulfide core domain protein 12
  • Source:Homo sapiens
  • Mass:9715.9 Da
  • Sequence Length:88 aa
  • Isoelectric Point:5.73
  • Activity:Antibacterial
  • Sequence
        VKEGIEKAGVCPADNVRCFKSDPPQCHTDQDCLGERKCCYLHCGFKCVIPVKELEEGGNKDEDVSRPYPEPGWEAKCPGSSSTRCPQK
  • Function:Antibacterial protein. Putative acid-stable proteinase inhibitor.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003637    From 1 To 88 E-value: 0 Score: 179
        VKEGIEKAGVCPADNVRCFKSDPPQCHTDQDCLGERKCCYLHCGFKCVIPVKELEEGGNKDEDVSRPYPEPGWEAKCPGSSSTRCPQK
  • 2. L01A003587    From 1 To 88 E-value: 0 Score: 177
        VKEDIEKAGVCPADNVRCFKSDPPQCHTDQDCLGERKCCYLHCGFKCVIPVKELEEGGNKDEDVSRPYPEPGWEAKCPGSSSTRCPQK
  • 3. L01A003592    From 1 To 88 E-value: 8.00141e-43 Score: 163
        VKGGIEKAGVCPADNVRCFKSDPPQCHTDQDCLGERKCCYLHCGFKCVIPVKKLEEGGNKDEDVSGPCPEPGWEAKSPGSSSTGCPQK
  • 4. L01A003588    From 1 To 88 E-value: 1.00053e-42 Score: 163
        VKGGIEKAGVCPADNIRCFKSDPPQCHTDQDCLGERKCCYLHCGFKCVIPVKKLEEGGNKDEDVSGPCPEPGWEAKSPGSSSTGCPQK
  • 5. L01A003591    From 1 To 87 E-value: 1.00053e-42 Score: 163
        VKGGIEKAGVCPADNVRCFKSNPPQCHTDQDCLGERKCCYLHCGFKCVIPVKKLEEGGNKDEDVSGPHPEPGWEAKSPGSSSTGCPQ

Structure

  •   Domains
  •   1  Name:4-disulphide_core    Interpro Link:IPR015874
  •   2  Name:Whey_acidic_protein_4-diS_core    Interpro Link:IPR008197
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Gilbert J.G.R.,Burton J.,Ashurst J.L.,Matthews L.H.,Deloukas P.,
  •   Title:The DNA sequence and comparative analysis of human chromosome 20.
  •   Journal:Nature, 2001, 414, 865-871  [MEDLINE:21638749]
  •   [2]  Clauss A.,Lundwall A.,
  •   Title:Identification of a novel protease inhibitor gene that is highly expressed in the prostate.
  •   Journal:Biochem. Biophys. Res. Commun., 2002, 290, 452-456  [MEDLINE:21638013]
  •   [3]  Baldwin D.T.,Baker K.,Abaya E.,Gurney A.L.,Clark H.F.,
  •   Title:The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
  •   Journal:Genome Res., 2003, 13, 2265-2270  [MEDLINE:22887296]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: