Record in detail


General Info

  • lamp_id:L01A003655
  • Name:DB132_PANTR
  • FullName:Beta-defensin 132
  • Source:Pan troglodytes
  • Mass:8359.5 Da
  • Sequence Length:73 aa
  • Isoelectric Point:10.25
  • Activity:Antibacterial
  • Sequence
        GGSKCVSNTPGYCRTYCHWGETALFMCNASRKCCVSYSFLPKADLPRLIGNHWQSRRRNTQRKDKKQQTTVTS
  • Function:Has antibacterial activity (Potential).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003655    From 1 To 73 E-value: 3e-40 Score: 155
        GGSKCVSNTPGYCRTYCHWGETALFMCNASRKCCVSYSFLPKADLPRLIGNHWQSRRRNTQRKDKKQQTTVTS
  • 2. L12A02757|    From 1 To 73 E-value: 1e-39 Score: 152
        GGSKCVSNTPGYCRTYCHWGETALFMCNASRKCCVSYSFLPKPDLPRLIGNHWQSRRRNTQRKDKKQQTTVTS
  • 3. L05A0DEF32    From 23 To 95 E-value: 2e-38 Score: 149
        GGSKCVSNTPGYCRTCCHWGETALFMCNASRKCCISYSFLPKPDLPQLIGNHWQSRRRNTQRKDKKQQTTVTS
  • 4. L01A003654    From 1 To 73 E-value: 4e-38 Score: 148
        GGSKCVSNTPGYCRTYCHQGETALFMCNASRKCCVSYSFLPKPDLPQLIGNHWQSRRRNTQRKDKKQQTTVTS
  • 5. L01A003724    From 1 To 73 E-value: 9e-38 Score: 147
        GGSKCVSNTPGYCRTCCHWGETALFMCNASRKCCISYSFLPKPDLPQLIGNHWQSRRRNTQRKDKKQQTTVTS

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Zhang G.,Blecha F.,Sang Y.,Cai Y.,Patil A.A.,
  •   Title:Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract.
  •   Journal:Physiol. Genomics, 2005, 23, 5-17  [PubMed:16033865]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: