Record in detail


General Info

  • lamp_id:L01A003680
  • Name:DFB12_RAT
  • FullName:Beta-defensin 12
  • Source:Rattus norvegicus
  • Mass:5767.6 Da
  • Sequence Length:51 aa
  • Isoelectric Point:8.5
  • Activity:Antibacterial
  • Sequence
        GLEYSQSFPGGEFAVCETCRLGRGKCRRTCLDSEKIAGKCKLNFFCCRERI
  • Function:Has antibacterial activity (By similarity).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003680    From 1 To 51 E-value: 2e-24 Score: 102
        GLEYSQSFPGGEFAVCETCRLGRGKCRRTCLDSEKIAGKCKLNFFCCRERI
  • 2. L05ADEF163    From 35 To 85 E-value: 3e-23 Score: 98.6
        GLEYSQSFPGGEIAVCETCRLGRGKCRRTCIESEKIAGWCKLNFFCCRERI
  • 3. L01A003014    From 1 To 51 E-value: 1e-22 Score: 96.7
        GLEYSQSFPGGEIAVCETCRLGRGKCRRTCIESEKIAGWCKLNFFCCRERI
  • 4. L12A03268|    From 1 To 51 E-value: 2e-22 Score: 96.3
        GLEYSQSFPGGEFSVCETCRLGRGKCRKVCLESERIAGKCKLNFFCCRERI
  • 5. L12A09468|    From 28 To 78 E-value: 4e-19 Score: 85.1
        GLEYSQPFPGGEFAVCEPCWLGRGKCRRICTEDEKVVGNCKMNFFCCRRRI

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Zhang G.,Blecha F.,Sang Y.,Cai Y.,Patil A.A.,
  •   Title:Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract.
  •   Journal:Physiol. Genomics, 2005, 23, 5-17  [PubMed:16033865]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: