Record in detail


General Info

  • lamp_id:L01A003682
  • Name:DFB14_RAT
  • FullName:Beta-defensin 14
  • Source:Rattus norvegicus
  • Mass:5245.3 Da
  • Sequence Length:45 aa
  • Isoelectric Point:11.29
  • Activity:Antibacterial
  • Sequence
        FIPKSLRRFFCRVRGGRCAILNCLGKEEQIGRCSNRGQKCCRKKK
  • Function:Has antibacterial activity (By similarity).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003682    From 1 To 45 E-value: 5e-20 Score: 88.2
        FIPKSLRRFFCRVRGGRCAILNCLGKEEQIGRCSNRGQKCCRKKK
  • 2. L01A002474    From 1 To 45 E-value: 7e-18 Score: 80.9
        FLPKTLRKFFCRIRGGRCAVLNCLGKEEQIGRCSNSGRKCCRKKK
  • 3. L11A000053    From 1 To 45 E-value: 6e-16 Score: 74.3
        FLPKTLRKFFARIRGGRAAVLNALGKEEQIGRASNSGRKCARKKK
  • 4. L11A006085    From 1 To 45 E-value: 8e-16 Score: 73.9
        FLPKTLRKFFARIRGGRAAVLNALGKEEQIGRASNSGRKAARKKK
  • 5. L11A001150    From 1 To 44 E-value: 0.000000000000003 Score: 72
        LPKTLRKFFARIRGGRAAVLNALGKEEQIGRASNSGRKCARKKK

Structure

  •   Domains
  •   1  Name:Defensin_beta-typ    Interpro Link:IPR001855
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Zhang G.,Blecha F.,Sang Y.,Cai Y.,Patil A.A.,
  •   Title:Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract.
  •   Journal:Physiol. Genomics, 2005, 23, 5-17  [PubMed:16033865]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: