Record in detail


General Info

  • lamp_id:L01A003683
  • Name:DFB18_RAT
  • FullName:Beta-defensin 18
  • Source:Rattus norvegicus
  • Mass:7345.4 Da
  • Sequence Length:62 aa
  • Isoelectric Point:8.11
  • Activity:Antibacterial
  • Sequence
        APQMKTRDVLERTHKCFLVGGECKSECSSWEYEYVFCYTGPCCVMREYKRVEKFSNTPKYTT
  • Function:Has antibacterial activity (By similarity).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003683    From 1 To 62 E-value: 9e-33 Score: 130
        APQMKTRDVLERTHKCFLVGGECKSECSSWEYEYVFCYTGPCCVMREYKRVEKFSNTPKYTT
  • 2. L01A003685    From 1 To 62 E-value: 2e-23 Score: 99
        APQMKTREVAERTHKCSLVRGTCKSECNSWEYKYNYCHTEPCCVVREYKRMEKLLSTPKYTT
  • 3. L12A03943|    From 4 To 53 E-value: 0.0000000000004 Score: 65.1
        VPQKKTREIAERKRECQLVRGACKPECNSWEYVYYYCDVNPCCVVREYQK
  • 4. L12A03945|    From 4 To 53 E-value: 0.0000000000006 Score: 64.7
        VPQKKTREVAERKRECQLVRGACKPECNSWEYVYYYCNVNPCCAVREYQK
  • 5. L12A03948|    From 4 To 53 E-value: 0.0000000000007 Score: 64.3
        VPQKNTREIAGRKRECYLVRGSCKSECNTWEYVYSYCDTEPCCVVREYQK

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Zhang G.,Blecha F.,Sang Y.,Cai Y.,Patil A.A.,
  •   Title:Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract.
  •   Journal:Physiol. Genomics, 2005, 23, 5-17  [PubMed:16033865]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: