Record in detail


General Info

  • lamp_id:L01A003684
  • Name:DFB17_MOUSE
  • FullName:Beta-defensin 17
  • Source:Mus musculus
  • Mass:5450.4 Da
  • Sequence Length:46 aa
  • Isoelectric Point:9.15
  • Activity:Antibacterial
  • Sequence
        KKSYPEYGSLDLRKECKMRRGHCKLQCSEKELRISFCIRPGTHCCM
  • Function:Has antibacterial activity (By similarity).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003684    From 1 To 46 E-value: 4e-22 Score: 95.1
        KKSYPEYGSLDLRKECKMRRGHCKLQCSEKELRISFCIRPGTHCCM
  • 2. L01A003648    From 1 To 46 E-value: 2e-19 Score: 85.9
        KRSYPEYGSLDLRKECRMSKGHCKLQCSENEIRIAFCIRPGTHCCI
  • 3. L12A05131|    From 1 To 46 E-value: 4e-16 Score: 75.1
        KKKYPEYGSLDLRRECRMGNGRCKNQCHENEIRIAYCIRPGTHCCL
  • 4. L05A0DEF12    From 20 To 65 E-value: 4e-16 Score: 75.1
        KKKYPEYGSLDLRRECRIGNGQCKNQCHENEIRIAYCIRPGTHCCL
  • 5. L01A003708    From 1 To 46 E-value: 7e-16 Score: 74.3
        KKKYPEYGSLDLRRECRIGNGQCKNQCHENEIRIAYCIRPGTHCCL

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Zhang G.,Blecha F.,Sang Y.,Cai Y.,Patil A.A.,
  •   Title:Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract.
  •   Journal:Physiol. Genomics, 2005, 23, 5-17  [PubMed:16033865]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: