Record in detail


General Info

  • lamp_id:L01A003690
  • Name:DB136_HUMAN
  • FullName:Beta-defensin 136
  • Source:Homo sapiens
  • Mass:6523.6 Da
  • Sequence Length:57 aa
  • Isoelectric Point:8.88
  • Activity:Antibacterial
  • Sequence
        MFGNDGVKVRTCTSQKAVCFFGCPPGYRWIAFCHNILSCCKNMTRFQPPQAKDPWVH
  • Function:Has antibacterial activity (Potential).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A003690    From 1 To 57 E-value: 1e-30 Score: 123
        MFGNDGVKVRTCTSQKAVCFFGCPPGYRWIAFCHNILSCCKNMTRFQPPQAKDPWVH
  • 2. L01A003689    From 1 To 57 E-value: 9e-30 Score: 120
        MFGNDGVKVRTCTSQKAVCFFGCPPGYRWIAFCHNILSCCKNMTRFQPLQAKDPWVH
  • 3. L05A0DEF49    From 22 To 73 E-value: 2e-27 Score: 113
        MFGNDGVKVRTCTSQKAVCFFGCPPGYRWIAFCHNILSCCKNMTRFQPPQAK
  • 4. L05ADEF330    From 22 To 73 E-value: 0.000000000008 Score: 60.8
        VIGNSGVSFKPCTSEGGYCFFGCKLGWIWITYCNNIMSCCKKDTKHSLPQTK
  • 5. L12A03572|    From 1 To 39 E-value: 0.11 Score: 27.3
        GLLNEQCQRQEGNCVPMCRINEELVAFCDRFKKCCKNME

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Zhang G.,Blecha F.,Sang Y.,Cai Y.,Patil A.A.,
  •   Title:Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract.
  •   Journal:Physiol. Genomics, 2005, 23, 5-17  [PubMed:16033865]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: