Record in detail


General Info

  • lamp_id:L01A003692
  • Name:DB135_HUMAN
  • FullName:Beta-defensin 135
  • Source:Homo sapiens
  • Mass:6141.3 Da
  • Sequence Length:53 aa
  • Isoelectric Point:9.12
  • Activity:Antibacterial
  • Sequence
        GPNVYIQKIFASCWRLQGTCRPKCLKNEQYRILCDTIHLCCVNPKYLPILTGK
  • Function:Has antibacterial activity (Potential).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A06541|    From 25 To 77 E-value: 9e-28 Score: 114
        GPNVYIQKIFASCWRLQGTCRPKCLKNEQYRILCDTIHLCCVNPKYLPILTGK
  • 2. L12A06539|    From 25 To 77 E-value: 4e-27 Score: 111
        GPNVYIQKIFASCWRLQGTCRPKCLKNEQYHILCDTIHLCCVNPKYLPILTGK
  • 3. L01A003692    From 1 To 53 E-value: 4e-27 Score: 111
        GPNVYIQKIFASCWRLQGTCRPKCLKNEQYRILCDTIHLCCVNPKYLPILTGK
  • 4. L12A10770|    From 3 To 55 E-value: 1e-26 Score: 109
        GPNVYIQKIFASCWRLQGTCRPKCLKNEQYHILCDTIHLCCVNPKYLPILTGK
  • 5. L12A03935|    From 1 To 53 E-value: 2e-26 Score: 109
        GPNVYIQKIFASCWRLQGTCRPKCLKNEQYHILCDTIHLCCVNPKYLPILTGK

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Zhang G.,Blecha F.,Sang Y.,Cai Y.,Patil A.A.,
  •   Title:Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract.
  •   Journal:Physiol. Genomics, 2005, 23, 5-17  [PubMed:16033865]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: