Record in detail
General Info
- lamp_id:L01A003694
- Name:DB133_PANTR
- FullName:Beta-defensin 133
- Source:Pan troglodytes
- Mass:4759.6 Da
- Sequence Length:41 aa
- Isoelectric Point:8.38
- Activity:Antibacterial
- Sequence
VKCAVKDTYSCFIVRGKCRHECHDFEKPIGFCTKLNANCYM - Function:Has antibacterial activity (Potential).
Cross-Linking
- Cross-linking
- 1 Database:CAMP CAMPSQ2083
- 2 Database:dbAMP dbAMP_11800
- 3 Database:DRAMP DRAMP02685
- 4 Database:Uniprot Q30KJ6
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L12A10782| From 3 To 43 E-value: 5e-20 Score: 88.2
VKCAVKDTYSCFIVRGKCRHECHDFEKPIGFCTKLNANCYM - 2. L01A003694 From 1 To 41 E-value: 6e-20 Score: 87.8
VKCAVKDTYSCFIVRGKCRHECHDFEKPIGFCTKLNANCYM - 3. L12A11798| From 1 To 41 E-value: 6e-19 Score: 84.3
VKCAMKDTYSCFIMKGKCRHECHDFEKPIGFCTKLNANCYM - 4. L12A10833| From 2 To 42 E-value: 8e-19 Score: 84
VKCAMKDTYSCFIMRGKCRHECHDFEKPIGFCTKLNVNCYM - 5. L12A11801| From 1 To 41 E-value: 3e-18 Score: 82
VKCPMKDNYSCFIMRGKCRHECHDFEKPIGFCTKLNANCYM
Structure
- Domains
No domains found on LAMP database
- Structures
No structs found on LAMP database
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] Zhang G.,Blecha F.,Sang Y.,Cai Y.,Patil A.A.,
- Title:Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract.
- Journal:Physiol. Genomics, 2005, 23, 5-17 [PubMed:16033865]
Comments
- Comments
No comments found on LAMP database