Record in detail


General Info

  • lamp_id:L01A003694
  • Name:DB133_PANTR
  • FullName:Beta-defensin 133
  • Source:Pan troglodytes
  • Mass:4759.6 Da
  • Sequence Length:41 aa
  • Isoelectric Point:8.38
  • Activity:Antibacterial
  • Sequence
        VKCAVKDTYSCFIVRGKCRHECHDFEKPIGFCTKLNANCYM
  • Function:Has antibacterial activity (Potential).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A10782|    From 3 To 43 E-value: 5e-20 Score: 88.2
        VKCAVKDTYSCFIVRGKCRHECHDFEKPIGFCTKLNANCYM
  • 2. L01A003694    From 1 To 41 E-value: 6e-20 Score: 87.8
        VKCAVKDTYSCFIVRGKCRHECHDFEKPIGFCTKLNANCYM
  • 3. L12A11798|    From 1 To 41 E-value: 6e-19 Score: 84.3
        VKCAMKDTYSCFIMKGKCRHECHDFEKPIGFCTKLNANCYM
  • 4. L12A10833|    From 2 To 42 E-value: 8e-19 Score: 84
        VKCAMKDTYSCFIMRGKCRHECHDFEKPIGFCTKLNVNCYM
  • 5. L12A11801|    From 1 To 41 E-value: 3e-18 Score: 82
        VKCPMKDNYSCFIMRGKCRHECHDFEKPIGFCTKLNANCYM

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Zhang G.,Blecha F.,Sang Y.,Cai Y.,Patil A.A.,
  •   Title:Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract.
  •   Journal:Physiol. Genomics, 2005, 23, 5-17  [PubMed:16033865]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: