Record in detail
General Info
- lamp_id:L01A003695
- Name:DB133_HUMAN
- FullName:Beta-defensin 133
- Source:Homo sapiens
- Mass:4461.2 Da
- Sequence Length:38 aa
- Isoelectric Point:8.22
- Activity:Antibacterial
- Sequence
AVKDTYSCFIMRGKCRHECHDFEKPIGFCTKLNANCYM - Function:Has antibacterial activity (Potential).
Cross-Linking
- Cross-linking
- 1 Database:CAMP CAMPSQ2084
- 2 Database:dbAMP dbAMP_00716
- 3 Database:DRAMP DRAMP03628
- 4 Database:Uniprot Q30KQ1
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L01A003695 From 1 To 38 E-value: 1e-18 Score: 83.2
AVKDTYSCFIMRGKCRHECHDFEKPIGFCTKLNANCYM - 2. L12A10782| From 6 To 43 E-value: 3e-18 Score: 82
AVKDTYSCFIVRGKCRHECHDFEKPIGFCTKLNANCYM - 3. L01A003694 From 4 To 41 E-value: 4e-18 Score: 81.6
AVKDTYSCFIVRGKCRHECHDFEKPIGFCTKLNANCYM - 4. L12A11798| From 4 To 41 E-value: 9e-18 Score: 80.5
AMKDTYSCFIMKGKCRHECHDFEKPIGFCTKLNANCYM - 5. L12A10833| From 5 To 42 E-value: 1e-17 Score: 80.1
AMKDTYSCFIMRGKCRHECHDFEKPIGFCTKLNVNCYM
Structure
- Domains
No domains found on LAMP database
- Structures
No structs found on LAMP database
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] Zhang G.,Blecha F.,Sang Y.,Cai Y.,Patil A.A.,
- Title:Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract.
- Journal:Physiol. Genomics, 2005, 23, 5-17 [PubMed:16033865]
Comments
- Comments
No comments found on LAMP database