Record in detail


General Info

  • lamp_id:L01A003704
  • Name:DB115_HUMAN
  • FullName:Beta-defensin 115
  • Source:Homo sapiens
  • Mass:7241.3 Da
  • Sequence Length:61 aa
  • Isoelectric Point:8.84
  • Activity:Antibacterial
  • Sequence
        QTAPDGWIRRCYYGTGRCRKSCKEIERKKEKCGEKHICCVPKEKDKLSHIHDQKETSELYI
  • Function:Has antibacterial activity (By similarity).

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L05A0DEF16    From 28 To 88 E-value: 6e-32 Score: 127
        QTAPDGWIRRCYYGTGRCRKSCKEIERKKEKCGEKHICCVPKEKDKLSHIHDQKETSELYI
  • 2. L01A003704    From 1 To 61 E-value: 6e-31 Score: 124
        QTAPDGWIRRCYYGTGRCRKSCKEIERKKEKCGEKHICCVPKEKDKLSHIHDQKETSELYI
  • 3. L12A04350|    From 1 To 56 E-value: 1e-27 Score: 113
        GWIRRCYYGTGRCRKSCKEIERKKEKCGEKHICCVPKEKDKLSHIHDQKETSELYI
  • 4. L05ADEF351    From 28 To 81 E-value: 0.00000000000006 Score: 68.2
        QTSPEGWFRTCFYGMGKCRHVCRANEKKKERCGENSFCCLGETKSKLSNIPTNK
  • 5. L12A10281|    From 1 To 54 E-value: 0.0000000000002 Score: 65.9
        QTSPEGWFRTCFYGMGKCRHVCRANEKKKERCGENSFCCLGETKSKLSNIPTNK

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Gilbert J.G.R.,Burton J.,Ashurst J.L.,Matthews L.H.,Deloukas P.,
  •   Title:The DNA sequence and comparative analysis of human chromosome 20.
  •   Journal:Nature, 2001, 414, 865-871  [MEDLINE:21638749]
  •   [2]  Zhang G.,Blecha F.,Sang Y.,Cai Y.,Patil A.A.,
  •   Title:Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract.
  •   Journal:Physiol. Genomics, 2005, 23, 5-17  [PubMed:16033865]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: